Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

SimulationCraft 1015-01

for World of Warcraft 10.2.0.52038 PTR (hotfix 2023-11-03/52038, git build f486e91d50)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Created with Highcharts 4.2.3 Damage per Second(Click title for burst)249,036249,024248,999245,526buzzing_rune_3hissing_rune_3howling_rune_3Basebuzzing_rune_3Maximum: 295,525.1Upper quartile: 254,945.1Mean: 249,036.3Median: 248,758.9Lower quartile: 242,811.9Minimum: 214,687.2
Created with Highcharts 4.2.3 Damage Taken per Second(Click title for burst)4,9654,9524,9364,924buzzing_rune_3howling_rune_3hissing_rune_3Base

Additional Raid Information

Base : 245526 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
245526.0 245526.0 122.6 / 0.050% 35392.1 / 14.4% 19320.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.3 12.3 Astral Power 0.00% 67.4 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Base 245526
Astral Smolder 17876 7.3% 67.5 4.39s 79356 0 Periodic 118.8 45055 0 45055 0.0% 79.3%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.48 0.00 118.85 118.85 52.21 0.0000 2.0000 5354632.62 5354632.62 0.00% 22527.51 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 118.85 75 160 45055.35 9413 159960 45071.84 33118 58689 5354633 5354633 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (7885) 0.0% (3.2%) 8.6 31.67s 273734 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.64 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 13505 3.2% 153.8 1.70s 15376 12045 Direct 152.9 12010 23986 15470 28.9%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.79 152.86 0.00 0.00 0.00 1.2766 0.0000 2364668.39 2364668.39 0.00% 12044.79 12044.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.11% 108.69 24 291 12010.12 8044 20854 12000.64 10652 14364 1305435 1305435 0.00%
crit 28.89% 44.16 6 126 23986.40 15822 41709 23972.77 21086 29090 1059234 1059234 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.290
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:15880.22
Hungering Shadowflame 4073 1.7% 17.5 16.53s 69990 0 Direct 17.5 54116 108769 69987 29.0%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.46 17.46 0.00 0.00 0.00 0.0000 0.0000 1222102.64 1222102.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.96% 12.39 2 30 54115.94 35869 210762 53922.82 36201 123544 670505 670505 0.00%
crit 29.04% 5.07 0 17 108769.14 71739 421524 107868.47 0 416939 551597 551597 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 3726 1.5% 34.5 8.48s 32346 0 Direct 34.4 25151 50261 32430 29.0%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.53 34.44 0.00 0.00 0.00 0.0000 0.0000 1116992.67 1116992.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.01% 24.46 7 46 25151.17 24387 28658 25150.22 24696 26285 615180 615180 0.00%
crit 28.99% 9.98 0 23 50261.32 48773 57316 50261.37 0 54403 501813 501813 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21279.65
  • base_dd_max:21279.65
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 13214 5.4% 14.3 21.60s 275829 286816 Direct 14.3 9509 19513 13126 36.2%
Periodic 313.6 8597 17949 12019 36.6% 99.6%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.35 14.35 313.61 313.61 13.35 0.9618 0.9518 3957488.00 3957488.00 0.00% 12671.83 286816.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.84% 9.16 1 17 9509.34 6220 17968 9512.98 7774 13221 87105 87105 0.00%
crit 36.16% 5.19 0 13 19512.58 12441 36331 19477.44 0 30914 101229 101229 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.41% 198.87 132 267 8597.12 178 15804 8601.08 8040 9299 1709679 1709679 0.00%
crit 36.59% 114.74 72 169 17948.54 1103 31608 17959.58 16703 19727 2059475 2059475 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.25
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.10
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (23180) 0.0% (9.4%) 17.0 17.92s 408331 345823

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.01 0.00 0.00 0.00 0.00 1.1808 0.0000 0.00 0.00 0.00% 345822.67 345822.67

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 8486 3.5% 5.3 62.53s 480142 262476 Direct 5.3 331868 649697 482908 47.5%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 5.28 0.00 0.00 0.00 1.8293 0.0000 2550219.73 2550219.73 0.00% 262476.30 262476.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.48% 2.77 0 6 331868.12 191282 554922 324514.13 0 554184 919816 919816 0.00%
crit 47.52% 2.51 0 6 649696.76 399748 1092166 624798.00 0 1044254 1630404 1630404 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.36
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 6291 2.6% 6.0 53.40s 312728 414525 Direct 6.0 202774 425245 314468 50.2%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 5.98 0.00 0.00 0.00 0.7545 0.0000 1879870.10 1879870.10 0.00% 414524.83 414524.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 49.80% 2.98 0 7 202774.23 99033 321289 199065.37 0 314208 603643 603643 0.00%
crit 50.20% 3.00 0 7 425244.88 217873 639263 422198.27 0 628416 1276227 1276227 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.03
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 8403 3.4% 5.7 57.81s 442293 364750 Direct 5.7 287675 571482 444535 55.3%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.69 5.66 0.00 0.00 0.00 1.2127 0.0000 2517141.85 2517141.85 0.00% 364750.30 364750.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 44.73% 2.53 0 7 287674.83 147711 459541 276719.63 0 459541 728603 728603 0.00%
crit 55.27% 3.13 0 7 571481.91 317112 919081 564135.58 0 904423 1788539 1788539 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.72
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (21650) 0.0% (8.8%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 8076 3.3% 96.0 3.13s 25223 0 Direct 95.7 16881 35437 25291 45.3%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.97 95.71 0.00 0.00 0.00 0.0000 0.0000 2420669.28 2420669.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.68% 52.34 23 87 16881.16 9937 33998 16886.44 14811 19568 883493 883493 0.00%
crit 45.32% 43.38 20 76 35437.25 19874 67997 35453.84 30747 41016 1537177 1537177 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 8093 3.3% 96.3 3.10s 25199 0 Direct 96.0 16861 35383 25266 45.4%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.26 96.00 0.00 0.00 0.00 0.0000 0.0000 2425559.10 2425559.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.62% 52.44 22 85 16861.37 9937 33998 16866.01 14901 19652 884127 884127 0.00%
crit 45.38% 43.56 18 74 35382.52 19874 67997 35398.97 30164 40534 1541432 1541432 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 5481 2.2% 6.4 47.53s 256480 0 Direct 6.4 170729 358926 257244 46.0%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.41 6.39 0.00 0.00 0.00 0.0000 0.0000 1642986.74 1642986.74 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.03% 3.45 0 8 170728.88 101621 332535 169083.80 0 311134 589152 589152 0.00%
crit 45.97% 2.94 0 8 358926.24 200676 676514 351236.16 0 651918 1053835 1053835 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 5986 2.4% 26.0 11.50s 69255 76851 Direct 27.0 47031 93920 66691 41.9%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.98 26.98 0.00 0.00 0.00 0.9012 0.0000 1799090.90 1799090.90 0.00% 76851.38 76851.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.08% 15.67 3 28 47031.38 20723 92459 47028.27 38250 57001 736863 736863 0.00%
crit 41.92% 11.31 2 23 93920.21 41446 187129 93876.36 50198 112412 1062228 1062228 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.03
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 79090 (106791) 32.2% (43.5%) 116.8 2.55s 273736 280204 Direct 116.5 (154.9) 138619 287246 203154 43.4% (44.0%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.77 116.53 0.00 0.00 0.00 0.9769 0.0000 23672863.40 23672863.40 0.00% 280203.59 280203.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.58% 65.93 39 95 138619.34 90839 270262 138684.51 126265 155332 9139014 9139014 0.00%
crit 43.42% 50.60 27 80 287246.04 169598 540523 287468.84 258759 328354 14533849 14533849 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:83.47
  • if_expr:variable.starsurge_condition1
    st
    [X]:33.30
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 27701 11.3% 38.5 7.60s 215208 0 Direct 38.3 145843 300374 216250 45.6%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.53 38.35 0.00 0.00 0.00 0.0000 0.0000 8292201.79 8292201.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.44% 20.88 5 41 145842.71 94987 282600 145906.50 120070 184297 3044637 3044637 0.00%
crit 45.56% 17.47 4 36 300374.15 189973 565201 300620.44 246292 367016 5247565 5247565 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 13239 5.4% 17.4 18.05s 228142 237530 Direct 17.4 9512 19253 13370 39.6%
Periodic 314.6 8481 17197 11874 38.9% 99.9%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.39 17.39 314.57 314.57 16.39 0.9605 0.9519 3967695.86 3967695.86 0.00% 12550.52 237529.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.39% 10.50 3 20 9511.98 5655 16514 9503.18 7949 11540 99903 99903 0.00%
crit 39.61% 6.89 0 17 19253.00 11310 33028 19253.17 0 27908 132628 132628 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 61.08% 192.12 128 256 8481.26 960 14975 8480.52 8003 8984 1629431 1629431 0.00%
crit 38.92% 122.45 78 173 17197.30 5183 29950 17198.44 16089 18381 2105734 2105734 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.44
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.95
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (4312) 0.0% (1.8%) 8.6 32.00s 149702 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.64 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2246 0.9% 8.6 32.00s 77982 0 Direct 8.6 60495 120904 77979 28.9%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.64 8.64 0.00 0.00 0.00 0.0000 0.0000 673470.55 673470.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.05% 6.14 0 17 60494.55 58599 68863 60459.53 0 68863 371211 371211 0.00%
crit 28.95% 2.50 0 11 120903.86 117198 137726 111419.71 0 137726 302259 302259 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2066 0.8% 16.7 15.54s 37069 0 Direct 16.7 28768 57499 37070 28.9%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.71 16.71 0.00 0.00 0.00 0.0000 0.0000 619391.09 619391.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.11% 11.88 0 33 28768.43 27883 32767 28767.13 0 32411 341808 341808 0.00%
crit 28.89% 4.83 0 16 57498.97 55766 65534 56887.13 0 65534 277583 277583 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 23594 9.6% 117.9 2.49s 59931 63920 Direct 117.5 39879 82288 60158 47.8%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.91 117.47 0.00 0.00 0.00 0.9376 0.0000 7066680.04 7066680.04 0.00% 63920.04 63920.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.18% 61.30 32 95 39879.27 15347 130348 39884.86 35279 45786 2444527 2444527 0.00%
crit 47.82% 56.17 26 84 82288.33 30693 247179 82318.59 70067 94964 4622153 4622153 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:116.23

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
Base
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 192.29s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 66.81s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.67 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:35466.09
  • base_dd_max:35466.09
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.35s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Base
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 306.33s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.48
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 49.28s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.07 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.07
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.9 1.4 35.4s 33.5s 8.5s 25.15% 29.13% 1.4 (7.0) 8.7

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 49.7s
  • trigger_min/max:2.6s / 49.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.11% / 27.85%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.91%
  • balance_of_all_things_arcane_2:2.95%
  • balance_of_all_things_arcane_3:3.01%
  • balance_of_all_things_arcane_4:3.04%
  • balance_of_all_things_arcane_5:3.07%
  • balance_of_all_things_arcane_6:3.31%
  • balance_of_all_things_arcane_7:3.43%
  • balance_of_all_things_arcane_8:3.43%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.4 3.0 16.6s 14.2s 8.3s 50.77% 54.74% 3.0 (17.9) 17.8

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.0s
  • trigger_min/max:0.0s / 40.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.8s
  • uptime_min/max:45.59% / 54.57%

Stack Uptimes

  • balance_of_all_things_nature_1:5.96%
  • balance_of_all_things_nature_2:6.02%
  • balance_of_all_things_nature_3:6.13%
  • balance_of_all_things_nature_4:6.23%
  • balance_of_all_things_nature_5:6.37%
  • balance_of_all_things_nature_6:6.51%
  • balance_of_all_things_nature_7:6.66%
  • balance_of_all_things_nature_8:6.89%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.2 63.0 44.2s 4.1s 20.2s 48.61% 0.00% 35.1 (35.1) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.4s
  • trigger_min/max:0.8s / 43.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.01% / 55.00%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.61%
  • balance_t31_4pc_buff_lunar_2:4.36%
  • balance_t31_4pc_buff_lunar_3:4.89%
  • balance_t31_4pc_buff_lunar_4:5.61%
  • balance_t31_4pc_buff_lunar_5:29.14%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.0 102.7 22.0s 2.6s 19.3s 90.56% 0.00% 49.0 (49.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.1s
  • trigger_min/max:0.8s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:87.27% / 93.05%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.53%
  • balance_t31_4pc_buff_solar_2:11.48%
  • balance_t31_4pc_buff_solar_3:15.97%
  • balance_t31_4pc_buff_solar_4:11.67%
  • balance_t31_4pc_buff_solar_5:43.92%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.2s 70.2s 10.8s 10.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 337.6s
  • trigger_min/max:12.0s / 337.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 37.56%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.89%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.90%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.91%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 114.4s 70.2s 45.8s 33.32% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 350.9s
  • trigger_min/max:12.0s / 337.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 338.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.32%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.2s 70.2s 10.8s 10.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 330.3s
  • trigger_min/max:12.0s / 330.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.50%

Stack Uptimes

  • best_friends_with_pip_1:0.90%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.91%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.92%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.93%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.9s 70.2s 45.9s 33.50% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 355.1s
  • trigger_min/max:12.0s / 330.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 322.6s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.50%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.1s 70.1s 10.8s 9.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 340.6s
  • trigger_min/max:12.0s / 340.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.40%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.90%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.91%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.92%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.1s 70.1s 45.7s 33.18% 0.00% 68.9 (68.9) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 353.1s
  • trigger_min/max:12.0s / 340.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 332.6s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.18%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.9s 58.3s 50.1s 80.18% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 348.0s
  • trigger_min/max:15.0s / 314.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.9s
  • uptime_min/max:47.16% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.18%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.6 0.0 44.9s 31.6s 41.3s 57.74% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 256.6s
  • trigger_min/max:0.0s / 149.5s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 260.4s
  • uptime_min/max:19.05% / 96.26%

Stack Uptimes

  • denizen_of_the_dream_1:38.64%
  • denizen_of_the_dream_2:14.65%
  • denizen_of_the_dream_3:3.67%
  • denizen_of_the_dream_4:0.66%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.02%
  • denizen_of_the_dream_7:0.01%
  • denizen_of_the_dream_8:0.00%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.2 0.7 20.3s 20.6s 3.0s 15.29% 20.62% 0.7 (1.3) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.2s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.3s
  • uptime_min/max:8.42% / 26.42%

Stack Uptimes

  • dreamstate_1:9.47%
  • dreamstate_2:5.82%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.2 1.0 44.7s 44.2s 20.6s 49.63% 52.76% 1.0 (1.0) 6.9

Buff Details

  • buff initial source:Base
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.5s
  • trigger_min/max:12.0s / 89.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.24% / 56.12%

Stack Uptimes

  • eclipse_lunar_1:49.63%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.9 5.5 22.3s 15.8s 20.1s 93.09% 96.25% 5.5 (5.5) 12.9

Buff Details

  • buff initial source:Base
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.3s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.9s
  • uptime_min/max:90.65% / 95.27%

Stack Uptimes

  • eclipse_solar_1:93.09%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.8s 306.8s 27.3s 13.21% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.2s
  • trigger_min/max:300.0s / 328.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.89% / 18.01%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.21%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.3 3.4 55.3s 31.6s 25.0s 43.84% 43.79% 3.4 (3.4) 4.8

Buff Details

  • buff initial source:Base
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 187.0s
  • trigger_min/max:0.0s / 149.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 162.2s
  • uptime_min/max:14.74% / 87.33%

Stack Uptimes

  • friend_of_the_fae_1:43.84%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.2 0.0 44.2s 44.2s 20.3s 48.72% 51.50% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:Base
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.5s
  • trigger_min/max:12.0s / 89.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.49% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.72%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.1s 99.1s 19.5s 23.36% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:Base
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 124.5s
  • trigger_min/max:90.0s / 124.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.34% / 26.45%

Stack Uptimes

  • kindled_soul_5:1.11%
  • kindled_soul_10:1.15%
  • kindled_soul_15:1.15%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.16%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.17%
  • kindled_soul_50:1.17%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.18%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.20%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.5s 20.5s 5.9s 25.50% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.5s
  • trigger_min/max:12.8s / 70.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.93% / 30.28%

Stack Uptimes

  • natures_grace_1:25.50%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.8s 18.43% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.9s
  • trigger_min/max:90.0s / 91.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.55% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.43%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.1 74.4s 68.2s 7.7s 6.37% 7.08% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:Base
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 345.7s
  • trigger_min/max:0.0s / 345.7s
  • trigger_pct:14.94%
  • duration_min/max:0.0s / 28.9s
  • uptime_min/max:0.00% / 28.73%

Stack Uptimes

  • owlkin_frenzy_1:6.37%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.2 109.5 38.4s 38.4s 34.3s 94.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.4s / 49.3s
  • trigger_min/max:24.4s / 49.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.3s
  • uptime_min/max:90.24% / 96.71%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.02%
  • primordial_arcanic_pulsar_8:5.25%
  • primordial_arcanic_pulsar_12:6.73%
  • primordial_arcanic_pulsar_16:6.80%
  • primordial_arcanic_pulsar_20:6.57%
  • primordial_arcanic_pulsar_24:6.07%
  • primordial_arcanic_pulsar_28:6.93%
  • primordial_arcanic_pulsar_32:8.28%
  • primordial_arcanic_pulsar_36:6.62%
  • primordial_arcanic_pulsar_40:7.19%
  • primordial_arcanic_pulsar_44:7.34%
  • primordial_arcanic_pulsar_48:6.86%
  • primordial_arcanic_pulsar_52:7.69%
  • primordial_arcanic_pulsar_56:6.76%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.7 3.7 16.5s 14.2s 6.4s 39.70% 39.90% 3.7 (3.7) 18.2

Buff Details

  • buff initial source:Base
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.5s
  • trigger_min/max:0.0s / 40.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s
  • uptime_min/max:35.65% / 42.62%

Stack Uptimes

  • solstice_1:39.70%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 96.0 14.7s 2.6s 14.0s 97.34% 0.00% 54.8 (54.8) 7.6

Buff Details

  • buff initial source:Base
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 21.1s
  • trigger_min/max:0.8s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.57% / 99.12%

Stack Uptimes

  • starlord_1:9.23%
  • starlord_2:14.76%
  • starlord_3:73.35%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.3 47.9s 5.5s 43.2s 90.19% 0.00% 54.5 (54.5) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:482.27

Trigger Details

  • interval_min/max:10.0s / 345.0s
  • trigger_min/max:5.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.7s
  • uptime_min/max:67.70% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.19%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 60.9s 45.5s 16.5s 23.69% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:Base
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 221.8s
  • trigger_min/max:0.0s / 221.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 82.3s
  • uptime_min/max:4.72% / 60.08%

Stack Uptimes

  • wafting_devotion_1:23.69%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 49.3s 49.3s 21.7s 43.80% 42.92% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:Base
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.0s
  • trigger_min/max:45.0s / 82.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.57% / 50.76%

Stack Uptimes

  • warrior_of_elune_1:20.40%
  • warrior_of_elune_2:5.27%
  • warrior_of_elune_3:18.13%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:Base
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:Base
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:Base
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:Base
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:Base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:Base
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:Base
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.6 2.0 21.0 31.6s 0.0s 149.5s
Primordial Arcanic Pulsar 7.3 6.0 9.0 40.0s 29.2s 49.3s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.60% 0.4s 0.0s 2.8s
Astral Smolder 79.47% 60.17% 94.59% 15.6s 0.0s 136.0s
Incarnation (Total) 48.72% 43.49% 55.00% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 28.47% 26.31% 30.79% 11.7s 0.0s 12.0s
Lunar Eclipse Only 0.91% 0.71% 1.12% 2.7s 2.5s 2.7s
Solar Eclipse Only 44.37% 36.29% 50.31% 11.0s 0.0s 15.0s
No Eclipse 5.99% 3.67% 8.49% 1.4s 0.0s 3.6s
Friend of the Fae 43.84% 14.74% 87.33% 25.0s 0.0s 162.2s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.8310.00037.04147.60625.90974.671
Full Moon
New Moon
Half Moon
0.3410.00026.7465.8015.28532.360

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.094.4%57.8549.9%0.000.0%52.9845.7%
Starfire24.9792.6%0.000.0%2.007.4%0.010.0%
Starsurge0.000.0%46.6539.9%0.000.0%70.1360.1%
New Moon0.020.4%0.254.2%0.000.0%5.7495.4%
Half Moon0.000.0%0.335.8%0.000.0%5.3694.2%
Full Moon0.201.7%3.1126.6%0.070.6%8.3271.0%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Base
Nature's BalanceAstral Power99.48198.865.41%2.000.100.05%
Full MoonAstral Power5.31265.177.21%49.930.380.14%
Half MoonAstral Power5.69136.603.71%24.000.000.00%
MoonfireAstral Power14.3586.022.34%6.000.060.07%
New MoonAstral Power6.0172.131.96%12.000.000.00%
Orbit BreakerAstral Power6.41191.125.20%29.841.050.55%
Shooting Stars (Moonfire)Astral Power95.97191.755.21%2.000.200.10%
Shooting Stars (Sunfire)Astral Power96.26192.325.23%2.000.190.10%
StarfireAstral Power26.98395.2710.75%14.652.950.74%
SunfireAstral Power17.39104.332.84%6.000.010.01%
WrathAstral Power117.911844.1250.14%15.640.000.00%
Usage Type Count Total Tot% Avg RPE APR
Base
StarsurgeAstral Power 116.953689.86100.00%31.5531.608662.95
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896040.0 4119.56 4924.32 1715172.8 654659.7 -756425.6 896040.0
Astral Power 70.0 12.26 12.28 4.9 23.5 0.0 100.0

Statistics & Data Analysis

Fight Length
Base Fight Length
Count 20717
Mean 299.94
Minimum 240.01
Maximum 360.00
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 34.5536
5th Percentile 245.85
95th Percentile 353.93
( 95th Percentile - 5th Percentile ) 108.08
Mean Distribution
Standard Deviation 0.2401
95.00% Confidence Interval ( 299.47 - 300.41 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 510
0.1% Error 50981
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1020
DPS
Base Damage Per Second
Count 20717
Mean 245525.98
Minimum 212779.30
Maximum 288089.18
Spread ( max - min ) 75309.88
Range [ ( max - min ) / 2 * 100% ] 15.34%
Standard Deviation 9005.2312
5th Percentile 231319.97
95th Percentile 260998.84
( 95th Percentile - 5th Percentile ) 29678.87
Mean Distribution
Standard Deviation 62.5650
95.00% Confidence Interval ( 245403.36 - 245648.61 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5168
0.1 Scale Factor Error with Delta=300 692267
0.05 Scale Factor Error with Delta=300 2769067
0.01 Scale Factor Error with Delta=300 69226665
Priority Target DPS
Base Priority Target Damage Per Second
Count 20717
Mean 245525.98
Minimum 212779.30
Maximum 288089.18
Spread ( max - min ) 75309.88
Range [ ( max - min ) / 2 * 100% ] 15.34%
Standard Deviation 9005.2312
5th Percentile 231319.97
95th Percentile 260998.84
( 95th Percentile - 5th Percentile ) 29678.87
Mean Distribution
Standard Deviation 62.5650
95.00% Confidence Interval ( 245403.36 - 245648.61 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5168
0.1 Scale Factor Error with Delta=300 692267
0.05 Scale Factor Error with Delta=300 2769067
0.01 Scale Factor Error with Delta=300 69226665
DPS(e)
Base Damage Per Second (Effective)
Count 20717
Mean 245525.98
Minimum 212779.30
Maximum 288089.18
Spread ( max - min ) 75309.88
Range [ ( max - min ) / 2 * 100% ] 15.34%
Damage
Base Damage
Count 20717
Mean 71179056.35
Minimum 53456873.68
Maximum 92653937.04
Spread ( max - min ) 39197063.36
Range [ ( max - min ) / 2 * 100% ] 27.53%
DTPS
Base Damage Taken Per Second
Count 20717
Mean 4924.32
Minimum 1003.63
Maximum 10380.67
Spread ( max - min ) 9377.04
Range [ ( max - min ) / 2 * 100% ] 95.21%
HPS
Base Healing Per Second
Count 20717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Base Healing Per Second (Effective)
Count 20717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Base Heal
Count 20717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Base Healing Taken Per Second
Count 20717
Mean 4105.70
Minimum 757.12
Maximum 8081.04
Spread ( max - min ) 7323.92
Range [ ( max - min ) / 2 * 100% ] 89.19%
TMI
Base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
BaseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.48 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.60 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.44 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.25 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.07 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.03 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 83.47 starsurge,if=variable.starsurge_condition1
R 15.95 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.10 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.03 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.72 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.36 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.20 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 33.30 starsurge,if=variable.starsurge_condition2
Y 116.23 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVQYYYXRYXYWQQSQYYYYXYYXTOYXYXYYWQQQRQYQYYYSXYYXXYYPPQQRYQYYYYXYXPPQSQUQRVQOYYXXYYPPQQQYQSRYYYYFXXYPPQQYYQYYYYRSXXETUQQYQYYYXOYXPPQRXYYQQSYQYYYXPPYXYRWQQYYQVQQSTQYYWQPPQRQYYQYYYOXYYQQSPPQRYQYYFYYWQQYYQUQVQQRSYWQEPNQYQQYQTYQYYYRWQQYQSYYYXYYXOYXUWQQQRYQYYYYXSYXXYYPPQQYQRQYYYYXYXPPQSQVQQRTOQYFYYXYPPQQYYQSYRXYYXYWQPPQYQYYQEYYRYDSWQQUQVQQYOXYYXP

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask Base 50.0/100: 50% astral_power
Pre precombat 1 food Base 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation Base 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent Base 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket Base 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket Base 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket Base 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil Base 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.925 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.850 st L starfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak, wafting_devotion, corrupting_rage
0:02.624 st N incarnation_chosen_of_elune Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak, wafting_devotion, corrupting_rage
0:02.624 default D potion Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage
0:02.624 default E use_items Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:02.624 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.403 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.157 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:04.911 st T new_moon Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.666 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.420 st U half_moon Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.346 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.101 st V full_moon Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.490 st Q starsurge Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:10.245 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:11.001 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.757 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.512 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:13.266 st R sunfire Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:14.020 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.773 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.528 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:16.283 st W cancel_buff Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.283 st Q starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:17.061 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.816 st S moonfire Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:18.571 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.326 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.080 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.835 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.590 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.344 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.097 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:23.851 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:24.606 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:25.360 st T new_moon Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.127 st O warrior_of_elune Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.127 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.881 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.635 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.391 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.145 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.901 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.655 st W cancel_buff Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.655 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.495 st Q starsurge Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.305 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:33.084 st R sunfire Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), undulating_sporecloak, corrupting_rage
0:33.837 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), undulating_sporecloak, corrupting_rage
0:34.592 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), undulating_sporecloak, corrupting_rage
0:35.347 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), undulating_sporecloak, corrupting_rage
0:36.101 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), undulating_sporecloak, corrupting_rage
0:36.856 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), undulating_sporecloak, corrupting_rage
0:37.609 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), undulating_sporecloak, corrupting_rage
0:38.362 st S moonfire Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), undulating_sporecloak, corrupting_rage
0:39.117 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), undulating_sporecloak, corrupting_rage
0:39.870 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, undulating_sporecloak, corrupting_rage
0:40.625 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:41.602 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:42.578 st X starsurge Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:43.552 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:44.528 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:45.503 st P starfire Fluffy_Pillow 58.0/100: 58% astral_power natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, undulating_sporecloak, corrupting_rage
0:46.258 st P starfire Fluffy_Pillow 74.8/100: 75% astral_power natures_grace, primordial_arcanic_pulsar(32), warrior_of_elune(2), undulating_sporecloak, corrupting_rage
0:47.013 st Q starsurge Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, undulating_sporecloak, corrupting_rage
0:48.105 st Q starsurge Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, undulating_sporecloak, corrupting_rage
0:49.154 st R sunfire Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), undulating_sporecloak, corrupting_rage
0:50.166 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), undulating_sporecloak, corrupting_rage
0:51.177 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(2), balance_t31_4pc_buff_solar(2), undulating_sporecloak, corrupting_rage
0:52.290 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), undulating_sporecloak, corrupting_rage
0:53.364 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), undulating_sporecloak, corrupting_rage
0:54.439 st Y wrath Fluffy_Pillow 51.6/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), undulating_sporecloak, corrupting_rage
0:55.514 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), undulating_sporecloak, corrupting_rage
0:56.588 st X starsurge Fluffy_Pillow 87.6/100: 88% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), undulating_sporecloak, corrupting_rage
0:57.663 st Y wrath Fluffy_Pillow 53.6/100: 54% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), undulating_sporecloak, corrupting_rage
0:58.736 st X starsurge Fluffy_Pillow 69.6/100: 70% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:59.810 st P starfire Fluffy_Pillow 33.6/100: 34% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:01.418 st P starfire Fluffy_Pillow 51.6/100: 52% astral_power natures_grace, primordial_arcanic_pulsar(52), starlord(3), dreamstate, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:02.296 st Q starsurge Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, dreamstate, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:03.391 st S moonfire Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:04.441 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:05.491 st U half_moon Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:06.717 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:07.636 st R sunfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:08.612 st V full_moon Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:10.558 st Q starsurge Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:11.533 st O warrior_of_elune Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:11.533 st Y wrath Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:12.285 st Y wrath Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:13.261 st X starsurge Fluffy_Pillow 83.6/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:14.239 st X starsurge Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:15.214 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
1:16.189 st Y wrath Fluffy_Pillow 45.6/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage
1:17.163 st P starfire Fluffy_Pillow 55.6/100: 56% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, corrupting_rage
1:17.917 st P starfire Fluffy_Pillow 74.4/100: 74% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), warrior_of_elune(2), best_friends_with_pip_static, corrupting_rage
1:18.672 st Q starsurge Fluffy_Pillow 95.2/100: 95% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, warrior_of_elune, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage
1:19.763 st Q starsurge Fluffy_Pillow 93.2/100: 93% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage
1:20.814 st Q starsurge Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:21.825 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:22.800 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:23.873 st S moonfire Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:24.946 st R sunfire Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:25.942 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:26.935 st Y wrath Fluffy_Pillow 39.2/100: 39% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:27.930 st Y wrath Fluffy_Pillow 57.2/100: 57% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:28.927 st Y wrath Fluffy_Pillow 73.2/100: 73% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:29.921 default F natures_vigil Base 91.2/100: 91% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:30.000 st X starsurge Fluffy_Pillow 93.2/100: 93% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:30.994 st X starsurge Fluffy_Pillow 59.2/100: 59% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:31.988 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:32.983 st P starfire Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:33.738 st P starfire Fluffy_Pillow 54.0/100: 54% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), warrior_of_elune, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:34.492 st Q starsurge Fluffy_Pillow 72.8/100: 73% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:35.505 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:36.478 st Y wrath Fluffy_Pillow 6.8/100: 7% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:37.415 st Y wrath Fluffy_Pillow 24.8/100: 25% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:38.353 st Q starsurge Fluffy_Pillow 40.8/100: 41% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:39.291 st Y wrath Fluffy_Pillow 6.8/100: 7% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:40.287 st Y wrath Fluffy_Pillow 24.8/100: 25% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak
1:41.361 st Y wrath Fluffy_Pillow 42.8/100: 43% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
1:42.435 st Y wrath Fluffy_Pillow 60.8/100: 61% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
1:43.509 st R sunfire Fluffy_Pillow 78.8/100: 79% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
1:44.584 st S moonfire Fluffy_Pillow 84.8/100: 85% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
1:45.657 st X starsurge Fluffy_Pillow 92.8/100: 93% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:46.729 st X starsurge Fluffy_Pillow 58.8/100: 59% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:47.725 default E use_items Fluffy_Pillow 24.8/100: 25% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:47.725 st T new_moon Fluffy_Pillow 24.8/100: 25% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
1:48.480 st U half_moon Fluffy_Pillow 40.8/100: 41% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
1:49.685 st Q starsurge Fluffy_Pillow 68.8/100: 69% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(95)
1:50.698 st Q starsurge Fluffy_Pillow 44.8/100: 45% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(90)
1:51.672 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(85)
1:52.609 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(80)
1:53.547 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(75)
1:54.453 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(70)
1:55.356 st Y wrath Fluffy_Pillow 46.8/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(65)
1:56.262 st X starsurge Fluffy_Pillow 64.8/100: 65% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(60)
1:57.168 st O warrior_of_elune Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(55)
1:57.168 st Y wrath Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(55)
1:58.074 st X starsurge Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(50)
1:58.979 st P starfire Fluffy_Pillow 30.8/100: 31% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(45)
1:59.734 st P starfire Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, wafting_devotion, kindled_soul(40)
2:00.486 st Q starsurge Fluffy_Pillow 68.4/100: 68% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(40)
2:01.391 st R sunfire Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(35)
2:02.367 st X starsurge Fluffy_Pillow 74.4/100: 74% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(30)
2:03.343 st Y wrath Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(25)
2:04.318 st Y wrath Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
2:05.292 st Q starsurge Fluffy_Pillow 78.4/100: 78% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
2:06.493 st Q starsurge Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
2:07.650 st S moonfire Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
2:08.762 st Y wrath Fluffy_Pillow 20.4/100: 20% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:09.874 st Q starsurge Fluffy_Pillow 40.4/100: 40% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:10.988 st Y wrath Fluffy_Pillow 8.4/100: 8% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:11.981 st Y wrath Fluffy_Pillow 24.4/100: 24% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:12.976 st Y wrath Fluffy_Pillow 42.4/100: 42% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:13.968 st X starsurge Fluffy_Pillow 60.4/100: 60% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:14.963 st P starfire Fluffy_Pillow 24.4/100: 24% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:15.717 st P starfire Fluffy_Pillow 45.2/100: 45% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:16.471 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:17.375 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:18.278 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:19.182 st R sunfire Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:20.087 st W cancel_buff Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:20.087 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:21.100 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:22.170 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:23.201 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:24.233 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:25.264 st V full_moon Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:27.070 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:28.045 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:29.020 st S moonfire Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:29.996 st T new_moon Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:30.749 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage
2:31.725 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
2:32.700 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
2:33.674 st W cancel_buff Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
2:33.674 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage
2:34.764 st P starfire Fluffy_Pillow 22.0/100: 22% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
2:36.339 st P starfire Fluffy_Pillow 36.0/100: 36% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:37.287 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:38.340 st R sunfire Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:39.350 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:40.360 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:41.116 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:42.091 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:43.065 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:44.139 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:45.211 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:46.285 st O warrior_of_elune Fluffy_Pillow 82.0/100: 82% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:46.285 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:47.358 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:48.433 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:49.507 st Q starsurge Fluffy_Pillow 80.0/100: 80% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:50.708 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:51.864 st S moonfire Fluffy_Pillow 14.0/100: 14% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:52.977 st P starfire Fluffy_Pillow 20.0/100: 20% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:53.733 st P starfire Fluffy_Pillow 36.8/100: 37% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:54.485 st Q starsurge Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:55.497 st R sunfire Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:56.473 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:57.449 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:58.424 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:59.498 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:00.571 default F natures_vigil Base 53.6/100: 54% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:00.571 st Y wrath Fluffy_Pillow 53.6/100: 54% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:01.645 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:02.719 st W cancel_buff Fluffy_Pillow 85.6/100: 86% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:02.719 st Q starsurge Fluffy_Pillow 85.6/100: 86% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(48), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:03.921 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:05.076 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:06.190 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:07.304 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:08.417 st U half_moon Fluffy_Pillow 15.6/100: 16% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:09.718 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:10.692 st V full_moon Fluffy_Pillow 19.6/100: 20% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:12.640 st Q starsurge Fluffy_Pillow 75.6/100: 76% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:13.615 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:14.590 st R sunfire Fluffy_Pillow 21.6/100: 22% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:15.564 st S moonfire Fluffy_Pillow 29.6/100: 30% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:16.539 st Y wrath Fluffy_Pillow 37.6/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:17.512 st W cancel_buff Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:17.512 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:18.605 default E use_items Fluffy_Pillow 29.6/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:18.605 st P starfire Fluffy_Pillow 29.6/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
3:20.178 st N incarnation_chosen_of_elune Fluffy_Pillow 41.6/100: 42% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord, dreamstate(2), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
3:20.178 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord, dreamstate(2), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
3:21.133 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
3:21.885 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
3:22.806 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
3:23.693 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
3:24.447 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
3:25.332 st T new_moon Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
3:26.129 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
3:27.104 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
3:28.081 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
3:29.055 st Y wrath Fluffy_Pillow 37.6/100: 38% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
3:30.029 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
3:31.005 st R sunfire Fluffy_Pillow 73.6/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
3:31.980 st W cancel_buff Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
3:31.980 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
3:33.073 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
3:34.124 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
3:35.137 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
3:36.151 st S moonfire Fluffy_Pillow 19.6/100: 20% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
3:37.127 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
3:38.102 st Y wrath Fluffy_Pillow 45.6/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
3:39.078 st Y wrath Fluffy_Pillow 63.6/100: 64% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:40.054 st X starsurge Fluffy_Pillow 81.6/100: 82% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:41.028 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:42.005 st Y wrath Fluffy_Pillow 73.6/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:42.979 st X starsurge Fluffy_Pillow 91.6/100: 92% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:43.953 st O warrior_of_elune Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:43.953 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:44.858 st X starsurge Fluffy_Pillow 83.6/100: 84% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:45.764 st U half_moon Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:46.967 st W cancel_buff Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:46.967 st Q starsurge Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:47.980 st Q starsurge Fluffy_Pillow 61.6/100: 62% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:48.953 st Q starsurge Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:49.890 st R sunfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:50.796 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:51.702 st Q starsurge Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:52.606 st Y wrath Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:53.510 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:54.416 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:55.320 st Y wrath Fluffy_Pillow 59.6/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:56.226 st X starsurge Fluffy_Pillow 75.6/100: 76% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:57.132 st S moonfire Fluffy_Pillow 51.6/100: 52% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:58.035 st Y wrath Fluffy_Pillow 59.6/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:58.941 st X starsurge Fluffy_Pillow 75.6/100: 76% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:59.848 st X starsurge Fluffy_Pillow 49.6/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:00.753 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:01.659 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:02.564 st P starfire Fluffy_Pillow 49.6/100: 50% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:03.317 st P starfire Fluffy_Pillow 68.4/100: 68% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:04.072 st Q starsurge Fluffy_Pillow 85.2/100: 85% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:05.086 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:06.059 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:06.995 st Q starsurge Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:07.932 st R sunfire Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:08.909 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:09.983 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:11.055 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:12.129 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:13.203 st Y wrath Fluffy_Pillow 65.2/100: 65% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:14.277 st X starsurge Fluffy_Pillow 81.2/100: 81% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:15.352 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:16.425 st X starsurge Fluffy_Pillow 63.2/100: 63% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak
4:17.499 st P starfire Fluffy_Pillow 29.2/100: 29% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak
4:19.107 st P starfire Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(52), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
4:20.091 st Q starsurge Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, dreamstate, best_friends_with_aerwynn_static
4:21.182 st S moonfire Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn_static
4:22.233 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn_static
4:23.283 st V full_moon Fluffy_Pillow 3.2/100: 3% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_aerwynn_static
4:25.119 st Q starsurge Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
4:26.132 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
4:27.108 st R sunfire Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
4:28.084 st T new_moon Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
4:28.838 st O warrior_of_elune Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
4:28.953 st Q starsurge Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
4:29.928 st Y wrath Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak
4:30.682 default F natures_vigil Base 25.2/100: 25% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak
4:30.682 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak
4:31.657 st Y wrath Fluffy_Pillow 41.2/100: 41% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:32.632 st X starsurge Fluffy_Pillow 57.2/100: 57% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:33.608 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:34.582 st P starfire Fluffy_Pillow 43.2/100: 43% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:35.337 st P starfire Fluffy_Pillow 60.0/100: 60% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(16), warrior_of_elune(2), best_friends_with_aerwynn_static, corrupting_rage
4:36.092 st Q starsurge Fluffy_Pillow 80.8/100: 81% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, warrior_of_elune, best_friends_with_aerwynn_static, corrupting_rage
4:37.185 st Q starsurge Fluffy_Pillow 46.8/100: 47% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, corrupting_rage
4:38.234 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, corrupting_rage
4:39.246 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power natures_vigil, balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, corrupting_rage
4:40.257 st Q starsurge Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:41.367 st S moonfire Fluffy_Pillow 18.8/100: 19% astral_power natures_vigil, balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:42.441 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power natures_vigil, balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:43.517 st R sunfire Fluffy_Pillow 42.8/100: 43% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:44.591 st X starsurge Fluffy_Pillow 48.8/100: 49% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:45.666 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, corrupting_rage
4:46.739 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, corrupting_rage
4:47.812 st X starsurge Fluffy_Pillow 78.8/100: 79% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, corrupting_rage
4:48.886 st Y wrath Fluffy_Pillow 46.8/100: 47% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, corrupting_rage
4:49.960 st W cancel_buff Fluffy_Pillow 62.8/100: 63% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, corrupting_rage
4:49.960 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, corrupting_rage
4:51.162 st P starfire Fluffy_Pillow 30.8/100: 31% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord, warrior_of_elune, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:51.915 st P starfire Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:52.860 st Q starsurge Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:53.910 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:54.922 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:55.933 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:56.906 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:57.979 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:59.052 default E use_items Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:59.052 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
5:00.128 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
5:01.202 st R sunfire Fluffy_Pillow 49.6/100: 50% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
5:02.274 st Y wrath Fluffy_Pillow 57.6/100: 58% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
5:03.347 default D potion Fluffy_Pillow 77.6/100: 78% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
5:03.347 st S moonfire Fluffy_Pillow 77.6/100: 78% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
5:04.421 st W cancel_buff Fluffy_Pillow 85.6/100: 86% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
5:04.421 st Q starsurge Fluffy_Pillow 85.6/100: 86% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
5:05.624 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
5:06.780 st U half_moon Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
5:08.126 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
5:09.138 st V full_moon Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
5:11.085 st Q starsurge Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
5:12.060 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
5:13.036 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
5:14.011 st O warrior_of_elune Fluffy_Pillow 35.6/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
5:14.011 st X starsurge Fluffy_Pillow 35.6/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
5:14.986 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
5:15.962 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
5:16.937 st X starsurge Fluffy_Pillow 43.6/100: 44% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
5:17.914 st P starfire Fluffy_Pillow 15.6/100: 16% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 44802 42669 38981
Intellect 2089 0 15839 14916 12117 (7543)
Spirit 0 0 0 0 0
Health 896040 896040 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15839 14916 0
Crit 28.72% 22.51% 3151
Haste 25.27% 25.27% 4085
Versatility 9.14% 4.14% 849
Mana Regen 2560 2560 0
Attack Power 16473 15513 0
Mastery 28.50% 28.50% 7312
Armor 5330 5330 5330
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 489, stats: { 617 Armor, +2975 Sta, +230 Haste, +545 Vers, +704 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 489, stats: { 449 Armor, +2231 Sta, +228 Crit, +353 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 489, stats: { 505 Armor, +2975 Sta, +354 Haste, +421 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 486, stats: { 351 Armor, +2156 Sta, +304 Vers, +271 Mastery, +513 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="Base"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=489
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=486
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=489,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38981
# gear_intellect=12117
# gear_crit_rating=3151
# gear_haste_rating=4085
# gear_mastery_rating=7312
# gear_versatility_rating=849
# gear_armor=5330
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

buzzing_rune_3 : 249036 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
249036.3 249036.3 124.3 / 0.050% 35935.8 / 14.4% 19595.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.3 12.3 Astral Power 0.00% 67.4 99.9% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Created with Highcharts 4.2.3Time (seconds)Damage per secondbuzzing_rune_3 Damage per second01002003000k250k500k
Created with Highcharts 4.2.3Damage per Execute Timebuzzing_rune_3 Damage per Execute Timenew_moonhalf_moonmoons_talentmoonfirestarsurgefull_moonsunfirestarfirewrath0k50k100k150k200k250k300k350k400k4…450k
Created with Highcharts 4.2.3buzzing_rune_3 Damage Sourcesstarsurge: 32.1%goldrinns_fang: 11.3%wrath: 9.6%astral_smolder: 7.4%sunfire: 5.4%moonfire: 5.4%full_moon: 3.5%half_moon: 3.4%shooting_stars_sunfire: 3.3%shooting_stars_moonfire: 3.3%fey_missile: 3.2%new_moon: 2.5%starfire: 2.4%orbit_breaker: 2.2%hungering_shadowflame: 1.7%launched_thorns: 1.5%denizen_of_the_flame: 0.9%denizen_of_the_flame_secondary: 0.8%
Created with Highcharts 4.2.3# Iterationsbuzzing_rune_3 DPS Distributionmin=214687mean=249036max=295…max=2955250500100015002000
Created with Highcharts 4.2.3Time (seconds)Damage taken per secondbuzzing_rune_3 Damage taken per second01002003000k2.5k5k7.5k
Created with Highcharts 4.2.3buzzing_rune_3 Spent Timestarsurge: 114.0swrath: 110.5sstarfire: 23.4smoons_talent: 20.1ssunfire: 16.7smoonfire: 13.8sfull_moon: 9.7shalf_moon: 6.9snew_moon: 4.5s

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
buzzing_rune_3 249036
Astral Smolder 18542 7.4% 69.9 4.29s 79353 0 Periodic 120.6 45997 0 45997 0.0% 80.4%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 69.91 0.00 120.61 120.61 55.03 0.0000 2.0000 5547703.37 5547703.37 0.00% 22999.09 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 120.61 78 163 45997.34 9413 153851 46017.97 35407 63776 5547703 5547703 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (8010) 0.0% (3.2%) 8.7 31.22s 277099 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.66 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 13691 3.2% 154.0 1.68s 15578 12196 Direct 153.1 12008 23983 15674 30.6%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 154.01 153.05 0.00 0.00 0.00 1.2773 0.0000 2399031.71 2399031.71 0.00% 12196.09 12196.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.38% 106.19 20 264 12007.69 7778 20854 11997.56 10736 14386 1275098 1275098 0.00%
crit 30.62% 46.86 9 130 23982.55 15822 41121 23968.66 21158 28816 1123934 1123934 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.577
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:16417.53
Hungering Shadowflame 4128 1.7% 17.5 16.48s 70754 0 Direct 17.5 54172 108262 70755 30.7%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.49 17.49 0.00 0.00 0.00 0.0000 0.0000 1237130.22 1237130.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.34% 12.12 2 30 54171.76 35869 210762 53968.25 36024 134354 656788 656788 0.00%
crit 30.66% 5.36 0 16 108261.85 71739 421524 107347.94 0 421524 580342 580342 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 3774 1.5% 34.5 8.44s 32721 0 Direct 34.4 25150 50267 32809 30.5%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.54 34.45 0.00 0.00 0.00 0.0000 0.0000 1130212.43 1130212.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.51% 23.94 8 46 25150.18 24387 28658 25149.91 24682 26498 602195 602195 0.00%
crit 30.49% 10.50 1 26 50266.58 48773 57316 50269.68 48898 54445 528017 528017 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21279.65
  • base_dd_max:21279.65
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 13391 5.4% 14.3 21.60s 279554 290710 Direct 14.3 9513 19504 13297 37.9%
Periodic 313.3 8599 17943 12180 38.3% 99.4%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.33 14.33 313.29 313.29 13.33 0.9616 0.9518 4006280.89 4006280.89 0.00% 12841.84 290710.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 62.12% 8.90 1 16 9512.83 6256 18165 9517.17 7516 15033 84686 84686 0.00%
crit 37.88% 5.43 0 12 19504.06 12441 36331 19479.22 0 29824 105884 105884 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 61.68% 193.23 130 264 8598.76 528 15804 8602.84 8058 9211 1661525 1661525 0.00%
crit 38.32% 120.06 73 170 17942.82 2586 31608 17953.67 16677 19542 2154185 2154185 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.25
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.08
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (23451) 0.0% (9.4%) 17.0 17.93s 412978 349814

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.00 0.00 0.00 0.00 0.00 1.1806 0.0000 0.00 0.00 0.00% 349814.05 349814.05

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 8613 3.5% 5.3 62.56s 487344 266415 Direct 5.3 331888 651638 490255 49.5%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 5.28 0.00 0.00 0.00 1.8294 0.0000 2586086.71 2586086.71 0.00% 266414.62 266414.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.48% 2.66 0 6 331887.66 183953 563195 323323.49 0 563195 883774 883774 0.00%
crit 49.52% 2.61 0 6 651637.82 391318 1126391 630309.89 0 1126391 1702313 1702313 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.36
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 6354 2.5% 6.0 53.46s 315565 418295 Direct 6.0 202994 424997 317443 51.5%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 5.97 0.00 0.00 0.00 0.7545 0.0000 1896549.77 1896549.77 0.00% 418295.05 418295.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 48.46% 2.90 0 7 202994.07 106458 321981 198734.74 0 302279 587726 587726 0.00%
crit 51.54% 3.08 0 7 424996.87 200545 629872 422831.21 0 628416 1308824 1308824 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.03
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 8484 3.4% 5.7 57.84s 446554 368326 Direct 5.7 288078 571764 448872 56.7%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.68 5.65 0.00 0.00 0.00 1.2125 0.0000 2538131.57 2538131.57 0.00% 368325.58 368325.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 43.32% 2.45 0 7 288077.93 144910 459541 276101.29 0 452152 705530 705530 0.00%
crit 56.68% 3.20 0 7 571763.65 313193 923640 565237.81 0 877949 1832602 1832602 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.71
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (21910) 0.0% (8.8%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 8176 3.3% 95.9 3.10s 25529 0 Direct 95.6 16884 35433 25600 47.0%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.89 95.62 0.00 0.00 0.00 0.0000 0.0000 2447893.25 2447893.25 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.01% 50.69 22 87 16884.45 9937 33998 16889.50 14864 19651 855868 855868 0.00%
crit 46.99% 44.93 20 79 35432.82 19874 67997 35447.75 31137 40920 1592025 1592025 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 8193 3.3% 96.2 3.09s 25501 0 Direct 95.9 16857 35376 25572 47.1%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.18 95.91 0.00 0.00 0.00 0.0000 0.0000 2452682.47 2452682.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.94% 50.78 25 89 16857.41 9937 33998 16863.08 14829 19437 856033 856033 0.00%
crit 47.06% 45.13 21 78 35376.20 19874 67997 35390.44 30404 40772 1596649 1596649 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 5541 2.2% 6.4 47.26s 259325 0 Direct 6.4 170766 359019 260209 47.5%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.40 6.38 0.00 0.00 0.00 0.0000 0.0000 1659249.83 1659249.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.48% 3.35 0 8 170765.92 100338 338257 169114.02 0 323842 571483 571483 0.00%
crit 47.52% 3.03 0 9 359019.13 200676 661738 352447.07 0 619793 1087767 1087767 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 6055 2.4% 25.9 11.51s 70155 77878 Direct 26.9 47088 93945 67550 43.7%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.91 26.91 0.00 0.00 0.00 0.9009 0.0000 1818053.66 1818053.66 0.00% 77877.65 77877.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.33% 15.16 4 28 47088.35 20723 95582 47078.06 36350 57273 713933 713933 0.00%
crit 43.67% 11.75 2 25 93945.46 41446 192425 93931.59 66608 112828 1104120 1104120 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:24.97
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 80063 (108104) 32.1% (43.4%) 116.7 2.55s 277098 283649 Direct 116.4 (154.7) 138634 287261 205662 45.1% (45.6%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.65 116.40 0.00 0.00 0.00 0.9769 0.0000 23939122.03 23939122.03 0.00% 283649.06 283649.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.90% 63.90 33 96 138634.21 83205 270262 138698.31 126054 153956 8859302 8859302 0.00%
crit 45.10% 52.49 28 81 287261.08 181679 540523 287476.57 258196 324491 15079820 15079820 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:83.26
  • if_expr:variable.starsurge_condition1
    st
    [X]:33.40
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 28041 11.3% 38.5 7.68s 217746 0 Direct 38.3 145869 300303 218833 47.2%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.51 38.32 0.00 0.00 0.00 0.0000 0.0000 8385241.06 8385241.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.75% 20.21 5 39 145869.25 87003 282600 145930.34 118469 177099 2948618 2948618 0.00%
crit 47.25% 18.10 4 37 300303.27 189973 565201 300495.99 246661 402987 5436623 5436623 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 13412 5.4% 17.4 18.05s 231085 240588 Direct 17.4 9511 19246 13525 41.2%
Periodic 314.2 8486 17204 12029 40.6% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.38 17.38 314.24 314.24 16.37 0.9606 0.9519 4015167.92 4015167.92 0.00% 12714.03 240587.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.77% 10.21 2 19 9510.74 5655 16643 9501.70 7588 12154 97112 97112 0.00%
crit 41.23% 7.16 0 16 19245.54 11310 33028 19248.23 0 25467 137889 137889 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.35% 186.51 127 270 8485.59 206 14975 8484.94 7989 8995 1582661 1582661 0.00%
crit 40.65% 127.73 72 181 17204.12 306 29950 17205.43 16131 18365 2197507 2197507 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.44
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.93
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (4373) 0.0% (1.8%) 8.6 32.11s 151600 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.64 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2278 0.9% 8.6 32.11s 78975 0 Direct 8.6 60480 120887 78974 30.6%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.64 8.64 0.00 0.00 0.00 0.0000 0.0000 682288.68 682288.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.38% 5.99 0 18 60480.40 58599 68863 60408.60 0 68863 362531 362531 0.00%
crit 30.62% 2.65 0 11 120887.43 117198 137726 113422.69 0 137726 319758 319758 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2094 0.8% 16.7 15.57s 37533 0 Direct 16.7 28766 57479 37533 30.5%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.72 16.72 0.00 0.00 0.00 0.0000 0.0000 627423.96 627423.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.47% 11.61 2 31 28766.17 27883 32767 28765.11 27883 31853 334054 334054 0.00%
crit 30.53% 5.10 0 18 57478.64 55766 65534 56956.50 0 65534 293370 293370 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 23888 9.6% 117.8 2.49s 60654 64687 Direct 117.4 39865 82287 60885 49.6%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.83 117.38 0.00 0.00 0.00 0.9377 0.0000 7146856.94 7146856.94 0.00% 64686.80 64686.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.45% 59.22 32 92 39865.43 15347 125456 39870.69 34681 45954 2360716 2360716 0.00%
crit 49.55% 58.16 30 86 82286.94 30693 249898 82322.67 70797 94794 4786141 4786141 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:116.14

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
buzzing_rune_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:buzzing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:buzzing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:buzzing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 191.81s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 69.22s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.66 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:buzzing_rune_3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:35466.09
  • base_dd_max:35466.09
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.33s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:buzzing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 306.45s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 49.23s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.06 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.06
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.9 1.4 35.4s 33.5s 8.4s 25.15% 29.14% 1.4 (7.0) 8.7

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 49.7s
  • trigger_min/max:2.7s / 49.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.03% / 27.78%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.91%
  • balance_of_all_things_arcane_2:2.95%
  • balance_of_all_things_arcane_3:3.01%
  • balance_of_all_things_arcane_4:3.04%
  • balance_of_all_things_arcane_5:3.07%
  • balance_of_all_things_arcane_6:3.31%
  • balance_of_all_things_arcane_7:3.43%
  • balance_of_all_things_arcane_8:3.44%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.4 3.0 16.6s 14.2s 8.3s 50.76% 54.71% 3.0 (17.8) 17.8

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.0s
  • trigger_min/max:0.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.8s
  • uptime_min/max:45.83% / 54.41%

Stack Uptimes

  • balance_of_all_things_nature_1:5.96%
  • balance_of_all_things_nature_2:6.02%
  • balance_of_all_things_nature_3:6.13%
  • balance_of_all_things_nature_4:6.23%
  • balance_of_all_things_nature_5:6.36%
  • balance_of_all_things_nature_6:6.51%
  • balance_of_all_things_nature_7:6.66%
  • balance_of_all_things_nature_8:6.88%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.2 62.9 44.3s 4.1s 20.2s 48.63% 0.00% 35.1 (35.1) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.0s
  • trigger_min/max:0.8s / 42.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:42.83% / 55.00%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.61%
  • balance_t31_4pc_buff_lunar_2:4.36%
  • balance_t31_4pc_buff_lunar_3:4.88%
  • balance_t31_4pc_buff_lunar_4:5.59%
  • balance_t31_4pc_buff_lunar_5:29.18%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.0 102.6 22.0s 2.6s 19.4s 90.57% 0.00% 49.0 (49.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.1s
  • trigger_min/max:0.8s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:87.18% / 93.21%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.51%
  • balance_t31_4pc_buff_solar_2:11.45%
  • balance_t31_4pc_buff_solar_3:15.96%
  • balance_t31_4pc_buff_solar_4:11.67%
  • balance_t31_4pc_buff_solar_5:43.98%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.3s 70.3s 10.8s 10.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 334.3s
  • trigger_min/max:12.0s / 334.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.72%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 114.0s 70.3s 45.7s 33.40% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:13.0s / 353.4s
  • trigger_min/max:12.0s / 334.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 326.0s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.40%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.5s 70.5s 10.8s 10.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 340.5s
  • trigger_min/max:12.0s / 340.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.63%

Stack Uptimes

  • best_friends_with_pip_1:0.90%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.91%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.92%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.93%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.5s 70.5s 45.6s 33.32% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 356.1s
  • trigger_min/max:12.0s / 340.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 319.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.32%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.8s 70.8s 10.8s 9.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 340.7s
  • trigger_min/max:12.0s / 340.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.42%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.91%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.92%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.4s 70.8s 45.7s 33.27% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 352.5s
  • trigger_min/max:12.0s / 340.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 334.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.27%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.53% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.53%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.9s 58.5s 50.0s 80.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 356.0s
  • trigger_min/max:15.0s / 322.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.8s
  • uptime_min/max:47.63% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.15%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.7 0.0 44.9s 31.5s 41.5s 57.86% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 323.8s
  • trigger_min/max:0.0s / 149.0s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 290.3s
  • uptime_min/max:21.91% / 99.11%

Stack Uptimes

  • denizen_of_the_dream_1:38.68%
  • denizen_of_the_dream_2:14.67%
  • denizen_of_the_dream_3:3.73%
  • denizen_of_the_dream_4:0.67%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.01%
  • denizen_of_the_dream_7:0.01%
  • denizen_of_the_dream_8:0.00%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.2 0.7 20.3s 20.6s 3.0s 15.29% 20.60% 0.7 (1.3) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 55.9s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.5s
  • uptime_min/max:8.62% / 26.39%

Stack Uptimes

  • dreamstate_1:9.46%
  • dreamstate_2:5.83%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.2 1.0 44.7s 44.3s 20.6s 49.64% 52.78% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.0s
  • trigger_min/max:12.0s / 90.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.09% / 56.12%

Stack Uptimes

  • eclipse_lunar_1:49.64%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.5 22.3s 15.8s 20.2s 93.09% 96.26% 5.5 (5.5) 12.9

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.6s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.9s
  • uptime_min/max:90.62% / 95.31%

Stack Uptimes

  • eclipse_solar_1:93.09%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.9s 306.9s 27.4s 13.19% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.4s
  • trigger_min/max:300.0s / 328.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.89% / 18.03%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.19%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.3 3.4 55.2s 31.5s 25.0s 43.96% 43.91% 3.4 (3.4) 4.8

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 179.9s
  • trigger_min/max:0.0s / 149.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 142.6s
  • uptime_min/max:14.87% / 83.74%

Stack Uptimes

  • friend_of_the_fae_1:43.96%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.2 0.0 44.3s 44.3s 20.3s 48.73% 51.52% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.0s
  • trigger_min/max:12.0s / 90.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.34% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.73%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.0s 99.0s 19.5s 23.34% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 124.1s
  • trigger_min/max:90.0s / 124.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.39% / 26.44%

Stack Uptimes

  • kindled_soul_5:1.11%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.15%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.16%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.17%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.18%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.20%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.5s 20.5s 5.9s 25.47% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.4s
  • trigger_min/max:12.8s / 70.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.15% / 30.26%

Stack Uptimes

  • natures_grace_1:25.47%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.9s
  • trigger_min/max:90.0s / 91.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.55% / 21.05%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.1 74.2s 67.9s 7.8s 6.42% 7.10% 0.1 (0.1) 1.4

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.3s / 343.3s
  • trigger_min/max:0.0s / 343.3s
  • trigger_pct:14.94%
  • duration_min/max:0.0s / 35.0s
  • uptime_min/max:0.00% / 29.32%

Stack Uptimes

  • owlkin_frenzy_1:6.42%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.2 109.4 38.4s 38.4s 34.3s 94.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.0s / 49.9s
  • trigger_min/max:24.0s / 49.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.8s
  • uptime_min/max:90.77% / 96.83%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.02%
  • primordial_arcanic_pulsar_8:5.26%
  • primordial_arcanic_pulsar_12:6.72%
  • primordial_arcanic_pulsar_16:6.80%
  • primordial_arcanic_pulsar_20:6.58%
  • primordial_arcanic_pulsar_24:6.07%
  • primordial_arcanic_pulsar_28:6.91%
  • primordial_arcanic_pulsar_32:8.29%
  • primordial_arcanic_pulsar_36:6.64%
  • primordial_arcanic_pulsar_40:7.18%
  • primordial_arcanic_pulsar_44:7.32%
  • primordial_arcanic_pulsar_48:6.87%
  • primordial_arcanic_pulsar_52:7.70%
  • primordial_arcanic_pulsar_56:6.77%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.7 3.7 16.5s 14.2s 6.4s 39.69% 39.90% 3.7 (3.7) 18.2

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.6s
  • trigger_min/max:0.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s
  • uptime_min/max:35.98% / 42.43%

Stack Uptimes

  • solstice_1:39.69%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 95.9 14.7s 2.6s 14.1s 97.33% 0.00% 54.8 (54.8) 7.6

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.2s
  • trigger_min/max:0.8s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.67% / 99.24%

Stack Uptimes

  • starlord_1:9.21%
  • starlord_2:14.75%
  • starlord_3:73.38%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.2 48.3 48.0s 5.5s 43.3s 90.20% 0.00% 54.4 (54.4) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:482.27

Trigger Details

  • interval_min/max:10.0s / 340.0s
  • trigger_min/max:5.0s / 30.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.6s
  • uptime_min/max:71.83% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.20%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 61.2s 45.7s 16.5s 23.66% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 207.7s
  • trigger_min/max:0.0s / 207.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 80.5s
  • uptime_min/max:4.87% / 63.30%

Stack Uptimes

  • wafting_devotion_1:23.66%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 49.2s 49.2s 21.7s 43.82% 42.93% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.2s
  • trigger_min/max:45.0s / 82.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.78% / 51.14%

Stack Uptimes

  • warrior_of_elune_1:20.42%
  • warrior_of_elune_2:5.24%
  • warrior_of_elune_3:18.16%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.7 2.0 20.0 31.5s 0.0s 149.0s
Primordial Arcanic Pulsar 7.3 6.0 9.0 40.0s 29.2s 49.4s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.35% 0.4s 0.0s 2.8s
Astral Smolder 80.74% 60.29% 94.30% 16.2s 0.0s 114.0s
Incarnation (Total) 48.73% 43.34% 55.00% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 28.46% 26.33% 30.71% 11.7s 0.0s 12.0s
Lunar Eclipse Only 0.91% 0.71% 1.12% 2.7s 2.5s 2.7s
Solar Eclipse Only 44.36% 36.36% 50.54% 11.0s 0.0s 15.0s
No Eclipse 5.98% 3.59% 8.37% 1.4s 0.0s 3.5s
Friend of the Fae 43.96% 14.87% 83.74% 25.0s 0.0s 142.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.8290.00037.18947.53526.16370.406
Full Moon
New Moon
Half Moon
0.3420.00022.5395.8085.28527.847

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.124.4%57.7849.9%0.000.0%52.9445.7%
Starfire24.9192.5%0.000.0%2.007.4%0.010.0%
Starsurge0.000.0%46.5839.9%0.000.0%70.0760.1%
New Moon0.020.4%0.264.3%0.000.0%5.7395.3%
Half Moon0.000.0%0.335.8%0.000.0%5.3594.2%
Full Moon0.201.7%3.1026.5%0.080.6%8.3271.1%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
buzzing_rune_3
Nature's BalanceAstral Power99.38198.655.41%2.000.100.05%
Full MoonAstral Power5.31264.947.21%49.930.360.14%
Half MoonAstral Power5.68136.423.71%24.000.000.00%
MoonfireAstral Power14.3385.922.34%6.000.060.07%
New MoonAstral Power6.0172.121.96%12.000.000.00%
Orbit BreakerAstral Power6.40190.875.20%29.831.070.56%
Shooting Stars (Moonfire)Astral Power95.88191.565.21%2.000.200.10%
Shooting Stars (Sunfire)Astral Power96.18192.165.23%2.000.200.10%
StarfireAstral Power26.92394.3110.73%14.652.970.75%
SunfireAstral Power17.37104.242.84%6.000.010.01%
WrathAstral Power117.831842.6050.16%15.640.000.00%
Usage Type Count Total Tot% Avg RPE APR
buzzing_rune_3
StarsurgeAstral Power 116.833685.91100.00%31.5531.608769.70
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896040.0 4153.84 4964.87 1738142.0 653039.7 -610226.7 896040.0
Astral Power 70.0 12.26 12.28 5.0 23.5 0.0 100.0
Created with Highcharts 4.2.3buzzing_rune_3 Astral Power Gainswrath: 1842.6starfire: 394.3full_moon: 264.9Natures Balance: 198.7shooting_stars_sunfire: 192.2shooting_stars_moonfire: 191.6orbit_breaker: 190.9half_moon: 136.4sunfire: 104.2moonfire: 85.9new_moon: 72.1
Created with Highcharts 4.2.3Time (seconds)Average Astral Powerbuzzing_rune_3 Astral Power0100200300050100

Statistics & Data Analysis

Fight Length
buzzing_rune_3 Fight Length
Count 20754
Mean 299.62
Minimum 240.01
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.5148
5th Percentile 245.95
95th Percentile 353.90
( 95th Percentile - 5th Percentile ) 107.95
Mean Distribution
Standard Deviation 0.2396
95.00% Confidence Interval ( 299.15 - 300.09 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 510
0.1% Error 50976
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1017
DPS
buzzing_rune_3 Damage Per Second
Count 20754
Mean 249036.27
Minimum 214687.21
Maximum 295525.12
Spread ( max - min ) 80837.91
Range [ ( max - min ) / 2 * 100% ] 16.23%
Standard Deviation 9138.6810
5th Percentile 234486.00
95th Percentile 264538.97
( 95th Percentile - 5th Percentile ) 30052.97
Mean Distribution
Standard Deviation 63.4355
95.00% Confidence Interval ( 248911.93 - 249160.60 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5173
0.1 Scale Factor Error with Delta=300 712937
0.05 Scale Factor Error with Delta=300 2851746
0.01 Scale Factor Error with Delta=300 71293627
Priority Target DPS
buzzing_rune_3 Priority Target Damage Per Second
Count 20754
Mean 249036.27
Minimum 214687.21
Maximum 295525.12
Spread ( max - min ) 80837.91
Range [ ( max - min ) / 2 * 100% ] 16.23%
Standard Deviation 9138.6810
5th Percentile 234486.00
95th Percentile 264538.97
( 95th Percentile - 5th Percentile ) 30052.97
Mean Distribution
Standard Deviation 63.4355
95.00% Confidence Interval ( 248911.93 - 249160.60 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5173
0.1 Scale Factor Error with Delta=300 712937
0.05 Scale Factor Error with Delta=300 2851746
0.01 Scale Factor Error with Delta=300 71293627
DPS(e)
buzzing_rune_3 Damage Per Second (Effective)
Count 20754
Mean 249036.27
Minimum 214687.21
Maximum 295525.12
Spread ( max - min ) 80837.91
Range [ ( max - min ) / 2 * 100% ] 16.23%
Damage
buzzing_rune_3 Damage
Count 20754
Mean 72116074.75
Minimum 54604914.97
Maximum 93921820.80
Spread ( max - min ) 39316905.83
Range [ ( max - min ) / 2 * 100% ] 27.26%
DTPS
buzzing_rune_3 Damage Taken Per Second
Count 20754
Mean 4965.01
Minimum 1331.35
Maximum 9811.22
Spread ( max - min ) 8479.87
Range [ ( max - min ) / 2 * 100% ] 85.40%
HPS
buzzing_rune_3 Healing Per Second
Count 20754
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
buzzing_rune_3 Healing Per Second (Effective)
Count 20754
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
buzzing_rune_3 Heal
Count 20754
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
buzzing_rune_3 Healing Taken Per Second
Count 20754
Mean 4140.20
Minimum 799.79
Maximum 8623.42
Spread ( max - min ) 7823.63
Range [ ( max - min ) / 2 * 100% ] 94.48%
TMI
buzzing_rune_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
buzzing_rune_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
buzzing_rune_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.59 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.44 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.25 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.06 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 24.97 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 83.26 starsurge,if=variable.starsurge_condition1
R 15.93 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.08 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.03 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.71 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.36 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.15 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 33.40 starsurge,if=variable.starsurge_condition2
Y 116.14 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVYXYYXRYXYSWQQYQYYYYXYXOTYXYXXYRWQQQYYQYYYSXYYXXYPPWQQRYQYYYYYXXPPQSYQUQRYQQOVYXWQQPPQYYQSYYRYXYFWQYQPPQYYQYYQYRYSQEQTUQYQYYYXOYXPPWQRQQYYSYYXYXYWQPPQYQRYYYYXYYSQQQVQQRTYYPOPXYWQQYYQYYXSYXRYPPWQQFYQYYYYXYYXUWQQRQSEVXYPNQYYXTWQQYQYRXYYXSYXYYWQQQYQUQYQRYYYYWQQOSQYYYXYXPPRYWQQYQYYYYYXSXPPYQQQRVFQQTYYXYXYPPQQSRYQYYYOYXYYXWQPPQYQYYQRSYYDYWQEQUQQVXYXYPPRWQQSYQTYYYXXYOYXWY

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask buzzing_rune_3 50.0/100: 50% astral_power
Pre precombat 1 food buzzing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation buzzing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent buzzing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket buzzing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket buzzing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket buzzing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil buzzing_rune_3 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.925 st K moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.850 st L starfire Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.682 st N incarnation_chosen_of_elune Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.682 default D potion Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage
0:02.682 default E use_items Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:02.682 st Q starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.523 st Q starsurge Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.331 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.112 st T new_moon Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.867 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.621 st U half_moon Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.621 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.375 st V full_moon Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.876 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.629 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:11.384 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.138 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.892 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.646 st R sunfire Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:14.402 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.156 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.910 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.666 st S moonfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:17.418 st W cancel_buff Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.418 st Q starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.261 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.069 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.849 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.628 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:21.381 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.135 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.891 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:23.645 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:24.399 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:25.153 st X starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:25.908 st O warrior_of_elune Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:25.908 st T new_moon Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.661 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.416 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.172 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.926 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.681 st X starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.436 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.189 st R sunfire Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.944 st W cancel_buff Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.944 st Q starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.783 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:33.591 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:34.370 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:35.125 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:35.880 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:36.635 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:37.390 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:38.143 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:38.898 st S moonfire Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:39.653 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), corrupting_rage
0:40.407 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:41.384 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:42.361 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:43.337 st X starsurge Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:44.314 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:45.288 st P starfire Fluffy_Pillow 38.0/100: 38% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, undulating_sporecloak, corrupting_rage
0:46.043 st P starfire Fluffy_Pillow 58.8/100: 59% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), undulating_sporecloak, corrupting_rage
0:46.798 st W cancel_buff Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, undulating_sporecloak, corrupting_rage
0:46.798 st Q starsurge Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, undulating_sporecloak, corrupting_rage
0:47.891 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, undulating_sporecloak, corrupting_rage
0:48.942 st R sunfire Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:49.953 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:50.964 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:52.076 st Y wrath Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:53.150 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:54.224 st Y wrath Fluffy_Pillow 41.6/100: 42% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak
0:55.297 st Y wrath Fluffy_Pillow 57.6/100: 58% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak
0:56.370 st Y wrath Fluffy_Pillow 73.6/100: 74% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak
0:57.443 st X starsurge Fluffy_Pillow 91.6/100: 92% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak
0:58.515 st X starsurge Fluffy_Pillow 55.6/100: 56% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak
0:59.588 st P starfire Fluffy_Pillow 19.6/100: 20% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
1:01.196 st P starfire Fluffy_Pillow 35.6/100: 36% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
1:02.073 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, dreamstate, best_friends_with_urctos_static, undulating_sporecloak
1:03.167 st S moonfire Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:04.140 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:04.895 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:05.869 st U half_moon Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:07.005 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:07.859 st R sunfire Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:08.762 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:09.665 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:10.569 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:11.474 st O warrior_of_elune Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:11.474 st V full_moon Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:13.280 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:14.183 st X starsurge Fluffy_Pillow 85.6/100: 86% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:15.088 st W cancel_buff Fluffy_Pillow 59.6/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:15.088 st Q starsurge Fluffy_Pillow 59.6/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:16.100 st Q starsurge Fluffy_Pillow 31.6/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:17.074 st P starfire Fluffy_Pillow 3.6/100: 4% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(2), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:17.829 st P starfire Fluffy_Pillow 22.4/100: 22% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(2), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak
1:18.584 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
1:19.596 st Y wrath Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak
1:20.570 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak
1:21.544 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak
1:22.518 st S moonfire Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak
1:23.493 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak
1:24.566 st Y wrath Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak
1:25.640 st R sunfire Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak
1:26.713 st Y wrath Fluffy_Pillow 63.2/100: 63% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:27.785 st X starsurge Fluffy_Pillow 81.2/100: 81% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:28.857 st Y wrath Fluffy_Pillow 45.2/100: 45% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:29.929 default F natures_vigil buzzing_rune_3 63.2/100: 63% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:30.000 st W cancel_buff Fluffy_Pillow 65.2/100: 65% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:30.000 st Q starsurge Fluffy_Pillow 65.2/100: 65% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:31.201 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(40), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:32.356 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(40), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:33.510 st P starfire Fluffy_Pillow 15.2/100: 15% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(44), starlord(2), warrior_of_elune, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:34.265 st P starfire Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(44), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:35.111 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:36.049 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:36.954 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:37.858 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:38.762 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power natures_vigil, balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:39.667 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:40.661 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:41.655 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power natures_vigil, balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:42.650 st R sunfire Fluffy_Pillow 34.0/100: 34% astral_power natures_vigil, balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:43.643 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:44.638 st S moonfire Fluffy_Pillow 56.0/100: 56% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:45.632 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power eclipse_solar, primordial_arcanic_pulsar(56), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:46.745 default E use_items Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
1:46.745 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(100)
1:47.718 st T new_moon Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(100)
1:48.474 st U half_moon Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(95)
1:49.723 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(90)
1:50.735 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(85)
1:51.712 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(80)
1:52.687 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(75)
1:53.661 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(70)
1:54.639 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(65)
1:55.614 st X starsurge Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(60)
1:56.589 st O warrior_of_elune Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(55)
1:56.589 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(55)
1:57.563 st X starsurge Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
1:58.536 st P starfire Fluffy_Pillow 32.0/100: 32% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
1:59.289 st P starfire Fluffy_Pillow 48.8/100: 49% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
2:00.046 st W cancel_buff Fluffy_Pillow 69.6/100: 70% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
2:00.046 st Q starsurge Fluffy_Pillow 69.6/100: 70% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
2:01.139 st R sunfire Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
2:02.191 st Q starsurge Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
2:03.241 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(20)
2:04.254 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(15)
2:05.327 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, kindled_soul(10)
2:06.401 st S moonfire Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, kindled_soul(5)
2:07.474 st Y wrath Fluffy_Pillow 53.6/100: 54% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static
2:08.549 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static
2:09.623 st X starsurge Fluffy_Pillow 87.6/100: 88% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos(11), best_friends_with_urctos_static
2:10.696 st Y wrath Fluffy_Pillow 53.6/100: 54% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak
2:11.770 st X starsurge Fluffy_Pillow 69.6/100: 70% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak
2:12.843 st Y wrath Fluffy_Pillow 37.6/100: 38% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak
2:13.917 st W cancel_buff Fluffy_Pillow 53.6/100: 54% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak
2:13.917 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power eclipse_solar, primordial_arcanic_pulsar(40), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak
2:15.119 st P starfire Fluffy_Pillow 19.6/100: 20% astral_power natures_grace, primordial_arcanic_pulsar(44), starlord, warrior_of_elune, dreamstate, best_friends_with_urctos(6), best_friends_with_urctos_static
2:15.873 st P starfire Fluffy_Pillow 38.4/100: 38% astral_power natures_grace, primordial_arcanic_pulsar(44), starlord, best_friends_with_urctos(5), best_friends_with_urctos_static
2:16.821 st Q starsurge Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_urctos(4), best_friends_with_urctos_static
2:17.873 st Y wrath Fluffy_Pillow 16.4/100: 16% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_urctos(3), best_friends_with_urctos_static
2:18.884 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
2:19.896 st R sunfire Fluffy_Pillow 2.4/100: 2% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
2:20.871 st Y wrath Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:21.943 st Y wrath Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:23.016 st Y wrath Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:24.091 st Y wrath Fluffy_Pillow 68.4/100: 68% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:25.163 st X starsurge Fluffy_Pillow 86.4/100: 86% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:26.236 st Y wrath Fluffy_Pillow 50.4/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:27.310 st Y wrath Fluffy_Pillow 68.4/100: 68% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:28.385 st S moonfire Fluffy_Pillow 84.4/100: 84% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:29.457 st Q starsurge Fluffy_Pillow 90.4/100: 90% astral_power eclipse_solar, primordial_arcanic_pulsar(56), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:30.659 st Q starsurge Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:31.710 st Q starsurge Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:32.721 st V full_moon Fluffy_Pillow 2.4/100: 2% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:34.668 st Q starsurge Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:35.644 st Q starsurge Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:36.619 st R sunfire Fluffy_Pillow 6.4/100: 6% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:37.595 st T new_moon Fluffy_Pillow 12.4/100: 12% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:38.351 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:39.255 st Y wrath Fluffy_Pillow 46.4/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:40.160 st P starfire Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:41.515 st O warrior_of_elune Fluffy_Pillow 74.4/100: 74% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:41.589 st P starfire Fluffy_Pillow 74.4/100: 74% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:42.344 st X starsurge Fluffy_Pillow 97.2/100: 97% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:43.248 st Y wrath Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:44.002 st W cancel_buff Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:44.002 st Q starsurge Fluffy_Pillow 81.2/100: 81% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:45.014 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:45.987 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:46.924 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:47.860 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:48.892 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:49.887 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
2:50.883 st X starsurge Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:51.878 st S moonfire Fluffy_Pillow 13.2/100: 13% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:52.873 st Y wrath Fluffy_Pillow 51.2/100: 51% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:53.867 st X starsurge Fluffy_Pillow 67.2/100: 67% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:54.863 st R sunfire Fluffy_Pillow 33.2/100: 33% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:55.857 st Y wrath Fluffy_Pillow 39.2/100: 39% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:56.852 st P starfire Fluffy_Pillow 51.2/100: 51% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:57.607 st P starfire Fluffy_Pillow 70.0/100: 70% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:58.361 st W cancel_buff Fluffy_Pillow 86.8/100: 87% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:58.361 st Q starsurge Fluffy_Pillow 86.8/100: 87% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:59.374 st Q starsurge Fluffy_Pillow 54.8/100: 55% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:00.348 default F natures_vigil buzzing_rune_3 22.8/100: 23% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:00.348 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:01.285 st Q starsurge Fluffy_Pillow 40.8/100: 41% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:02.222 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:03.127 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:04.122 st Y wrath Fluffy_Pillow 46.8/100: 47% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:05.195 st Y wrath Fluffy_Pillow 62.8/100: 63% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:06.268 st X starsurge Fluffy_Pillow 82.8/100: 83% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:07.341 st Y wrath Fluffy_Pillow 46.8/100: 47% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:08.413 st Y wrath Fluffy_Pillow 64.8/100: 65% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:09.486 st X starsurge Fluffy_Pillow 84.8/100: 85% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:10.559 st U half_moon Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:11.856 st W cancel_buff Fluffy_Pillow 76.8/100: 77% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:11.856 st Q starsurge Fluffy_Pillow 76.8/100: 77% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:12.949 st Q starsurge Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:13.999 st R sunfire Fluffy_Pillow 24.8/100: 25% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:15.011 st Q starsurge Fluffy_Pillow 34.8/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:16.023 st S moonfire Fluffy_Pillow 8.8/100: 9% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:16.999 default E use_items Fluffy_Pillow 16.8/100: 17% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:16.999 st V full_moon Fluffy_Pillow 16.8/100: 17% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
3:18.947 st X starsurge Fluffy_Pillow 70.8/100: 71% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
3:19.923 st Y wrath Fluffy_Pillow 44.8/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
3:20.899 st P starfire Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
3:22.362 st N incarnation_chosen_of_elune Fluffy_Pillow 78.8/100: 79% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
3:22.362 st Q starsurge Fluffy_Pillow 78.8/100: 79% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
3:23.249 st Y wrath Fluffy_Pillow 50.8/100: 51% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
3:24.003 st Y wrath Fluffy_Pillow 70.8/100: 71% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
3:24.758 st X starsurge Fluffy_Pillow 88.8/100: 89% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
3:25.645 st T new_moon Fluffy_Pillow 62.8/100: 63% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
3:26.400 st W cancel_buff Fluffy_Pillow 74.8/100: 75% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
3:26.400 st Q starsurge Fluffy_Pillow 74.8/100: 75% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), solstice, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
3:27.392 st Q starsurge Fluffy_Pillow 50.8/100: 51% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(28), solstice, starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
3:28.348 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), solstice, starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
3:29.359 st Q starsurge Fluffy_Pillow 40.8/100: 41% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
3:30.368 st Y wrath Fluffy_Pillow 16.8/100: 17% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(35)
3:31.343 st R sunfire Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(30)
3:32.319 st X starsurge Fluffy_Pillow 40.8/100: 41% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(25)
3:33.294 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(20)
3:34.270 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(15)
3:35.245 st X starsurge Fluffy_Pillow 46.8/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
3:36.223 st S moonfire Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
3:37.198 st Y wrath Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:38.175 st X starsurge Fluffy_Pillow 78.8/100: 79% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:39.151 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:40.127 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:41.103 st W cancel_buff Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:41.103 st Q starsurge Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:42.195 st Q starsurge Fluffy_Pillow 66.8/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:43.245 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:44.258 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:45.233 st Q starsurge Fluffy_Pillow 34.8/100: 35% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:46.209 st U half_moon Fluffy_Pillow 8.8/100: 9% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:47.509 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:48.485 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:49.460 st Q starsurge Fluffy_Pillow 30.8/100: 31% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
3:50.434 st R sunfire Fluffy_Pillow 2.8/100: 3% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
3:51.412 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
3:52.389 st Y wrath Fluffy_Pillow 28.8/100: 29% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
3:53.363 st Y wrath Fluffy_Pillow 46.8/100: 47% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
3:54.337 st Y wrath Fluffy_Pillow 64.8/100: 65% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
3:55.313 st W cancel_buff Fluffy_Pillow 80.8/100: 81% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
3:55.313 st Q starsurge Fluffy_Pillow 80.8/100: 81% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
3:56.404 st Q starsurge Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
3:57.454 st O warrior_of_elune Fluffy_Pillow 26.8/100: 27% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
3:57.454 st S moonfire Fluffy_Pillow 26.8/100: 27% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
3:58.465 st Q starsurge Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
3:59.477 st Y wrath Fluffy_Pillow 6.8/100: 7% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
4:00.452 st Y wrath Fluffy_Pillow 24.8/100: 25% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
4:01.427 st Y wrath Fluffy_Pillow 40.8/100: 41% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak
4:02.404 st X starsurge Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak
4:03.379 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak
4:04.354 st X starsurge Fluffy_Pillow 48.8/100: 49% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak
4:05.330 st P starfire Fluffy_Pillow 20.8/100: 21% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:06.085 st P starfire Fluffy_Pillow 39.6/100: 40% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:06.840 st R sunfire Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:07.816 st Y wrath Fluffy_Pillow 64.4/100: 64% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:08.792 st W cancel_buff Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:08.792 st Q starsurge Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:09.886 st Q starsurge Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:10.936 st Y wrath Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:12.050 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:13.162 st Y wrath Fluffy_Pillow 2.4/100: 2% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:14.235 st Y wrath Fluffy_Pillow 18.4/100: 18% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:15.310 st Y wrath Fluffy_Pillow 36.4/100: 36% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:16.383 st Y wrath Fluffy_Pillow 52.4/100: 52% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:17.456 st Y wrath Fluffy_Pillow 68.4/100: 68% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:18.529 st X starsurge Fluffy_Pillow 88.4/100: 88% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:19.602 st S moonfire Fluffy_Pillow 52.4/100: 52% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:20.676 st X starsurge Fluffy_Pillow 58.4/100: 58% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:21.751 st P starfire Fluffy_Pillow 24.4/100: 24% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:22.504 st P starfire Fluffy_Pillow 41.2/100: 41% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:23.383 st Y wrath Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:24.359 st Q starsurge Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:25.451 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:26.501 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:27.420 st R sunfire Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:28.396 st V full_moon Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:30.342 default F natures_vigil buzzing_rune_3 77.2/100: 77% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:30.348 st Q starsurge Fluffy_Pillow 77.2/100: 77% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:31.253 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:32.157 st T new_moon Fluffy_Pillow 23.2/100: 23% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:32.911 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:33.816 st Y wrath Fluffy_Pillow 53.2/100: 53% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:34.720 st X starsurge Fluffy_Pillow 73.2/100: 73% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:35.623 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:36.526 st X starsurge Fluffy_Pillow 67.2/100: 67% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:37.430 st Y wrath Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:38.334 st P starfire Fluffy_Pillow 53.2/100: 53% astral_power natures_vigil, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), dreamstate, best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:39.089 st P starfire Fluffy_Pillow 67.2/100: 67% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:39.904 st Q starsurge Fluffy_Pillow 81.2/100: 81% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:40.917 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:41.890 st S moonfire Fluffy_Pillow 11.2/100: 11% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:42.827 st R sunfire Fluffy_Pillow 19.2/100: 19% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:43.766 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power natures_vigil, balance_of_all_things_nature(5), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:44.797 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power natures_vigil, balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:45.828 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:46.823 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:47.817 st Y wrath Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:48.811 st O warrior_of_elune Fluffy_Pillow 67.2/100: 67% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:48.811 st Y wrath Fluffy_Pillow 67.2/100: 67% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:49.807 st X starsurge Fluffy_Pillow 85.2/100: 85% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:50.802 st Y wrath Fluffy_Pillow 49.2/100: 49% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:51.797 st Y wrath Fluffy_Pillow 67.2/100: 67% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:52.793 st X starsurge Fluffy_Pillow 83.2/100: 83% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:53.787 st W cancel_buff Fluffy_Pillow 49.2/100: 49% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:53.787 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power eclipse_solar, primordial_arcanic_pulsar(40), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:54.900 st P starfire Fluffy_Pillow 15.2/100: 15% astral_power natures_grace, primordial_arcanic_pulsar(44), starlord, warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:55.655 st P starfire Fluffy_Pillow 32.0/100: 32% astral_power natures_grace, primordial_arcanic_pulsar(44), starlord, warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:56.411 st Q starsurge Fluffy_Pillow 52.8/100: 53% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:57.385 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:58.323 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:59.335 st Y wrath Fluffy_Pillow 0.8/100: 1% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
5:00.309 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
5:01.284 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
5:02.358 st R sunfire Fluffy_Pillow 2.8/100: 3% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
5:03.432 st S moonfire Fluffy_Pillow 12.8/100: 13% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
5:04.506 st Y wrath Fluffy_Pillow 18.8/100: 19% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
5:05.579 st Y wrath Fluffy_Pillow 34.8/100: 35% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
5:06.650 default D potion Fluffy_Pillow 52.8/100: 53% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:06.650 st Y wrath Fluffy_Pillow 52.8/100: 53% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:07.724 st W cancel_buff Fluffy_Pillow 70.8/100: 71% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:07.724 st Q starsurge Fluffy_Pillow 70.8/100: 71% astral_power eclipse_solar, primordial_arcanic_pulsar(56), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:08.925 default E use_items Fluffy_Pillow 38.8/100: 39% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:08.925 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
5:09.974 st U half_moon Fluffy_Pillow 14.8/100: 15% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
5:11.322 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
5:12.335 st Q starsurge Fluffy_Pillow 46.8/100: 47% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
5:13.309 st V full_moon Fluffy_Pillow 22.8/100: 23% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
5:15.256 st X starsurge Fluffy_Pillow 78.8/100: 79% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(3), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
5:16.234 st Y wrath Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
5:17.207 st X starsurge Fluffy_Pillow 66.8/100: 67% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
5:18.181 st Y wrath Fluffy_Pillow 40.8/100: 41% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
5:19.157 st P starfire Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
5:20.618 st P starfire Fluffy_Pillow 68.8/100: 69% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
5:21.496 st R sunfire Fluffy_Pillow 84.8/100: 85% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
5:22.471 st W cancel_buff Fluffy_Pillow 92.8/100: 93% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
5:22.471 st Q starsurge Fluffy_Pillow 92.8/100: 93% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
5:23.485 st Q starsurge Fluffy_Pillow 56.8/100: 57% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
5:24.459 st S moonfire Fluffy_Pillow 24.8/100: 25% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
5:25.398 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
5:26.153 st Q starsurge Fluffy_Pillow 50.8/100: 51% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
5:27.184 st T new_moon Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(10)
5:27.937 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(5)
5:28.931 st Y wrath Fluffy_Pillow 48.8/100: 49% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power
5:29.925 st Y wrath Fluffy_Pillow 64.8/100: 65% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power
5:30.919 st X starsurge Fluffy_Pillow 82.8/100: 83% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:31.914 st X starsurge Fluffy_Pillow 48.8/100: 49% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:32.908 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:33.903 st O warrior_of_elune Fluffy_Pillow 32.8/100: 33% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:33.903 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, wafting_devotion, elemental_potion_of_ultimate_power
5:34.897 st X starsurge Fluffy_Pillow 48.8/100: 49% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, elemental_potion_of_ultimate_power
5:35.892 st W cancel_buff Fluffy_Pillow 12.8/100: 13% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power
5:35.892 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 44802 42669 38981
Intellect 2089 0 15839 14916 12117 (7543)
Spirit 0 0 0 0 0
Health 896040 896040 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15839 14916 0
Crit 30.44% 24.23% 3461
Haste 25.27% 25.27% 4085
Versatility 9.14% 4.14% 849
Mana Regen 2560 2560 0
Attack Power 16473 15513 0
Mastery 28.50% 28.50% 7312
Armor 5330 5330 5330
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 489, stats: { 617 Armor, +2975 Sta, +230 Haste, +545 Vers, +704 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 489, stats: { 449 Armor, +2231 Sta, +228 Crit, +353 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 489, stats: { 505 Armor, +2975 Sta, +354 Haste, +421 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 486, stats: { 351 Armor, +2156 Sta, +304 Vers, +271 Mastery, +513 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Buzzing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="buzzing_rune_3"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:buzzing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=489
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=486
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=489,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38981
# gear_intellect=12117
# gear_crit_rating=3461
# gear_haste_rating=4085
# gear_mastery_rating=7312
# gear_versatility_rating=849
# gear_armor=5330
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

hissing_rune_3 : 249024 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
249024.3 249024.3 124.3 / 0.050% 35792.5 / 14.4% 19598.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.3 12.3 Astral Power 0.00% 67.4 100.1% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Created with Highcharts 4.2.3Time (seconds)Damage per secondhissing_rune_3 Damage per second01002003000k250k500k
Created with Highcharts 4.2.3Damage per Execute Timehissing_rune_3 Damage per Execute Timenew_moonhalf_moonmoons_talentmoonfirestarsurgefull_moonsunfirestarfirewrath0k50k100k150k200k250k300k350k400k4…450k
Created with Highcharts 4.2.3hissing_rune_3 Damage Sourcesstarsurge: 32.3%goldrinns_fang: 11.3%wrath: 9.6%astral_smolder: 7.2%sunfire: 5.4%moonfire: 5.4%full_moon: 3.5%half_moon: 3.4%shooting_stars_sunfire: 3.3%shooting_stars_moonfire: 3.3%fey_missile: 3.2%new_moon: 2.6%starfire: 2.4%orbit_breaker: 2.2%hungering_shadowflame: 1.6%launched_thorns: 1.5%denizen_of_the_flame: 0.9%denizen_of_the_flame_secondary: 0.8%
Created with Highcharts 4.2.3# Iterationshissing_rune_3 DPS Distributionmin=215575mean=249024max=289…max=2894390500100015002000
Created with Highcharts 4.2.3Time (seconds)Damage taken per secondhissing_rune_3 Damage taken per second01002003000k2.5k5k7.5k
Created with Highcharts 4.2.3hissing_rune_3 Spent Timestarsurge: 114.1swrath: 110.6sstarfire: 23.4smoons_talent: 20.1ssunfire: 16.7smoonfire: 13.8sfull_moon: 9.7shalf_moon: 6.9snew_moon: 4.5s

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
hissing_rune_3 249024
Astral Smolder 18027 7.2% 67.4 4.38s 80104 0 Periodic 118.8 45475 0 45475 0.0% 79.2%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.44 0.00 118.80 118.80 52.18 0.0000 2.0000 5402042.16 5402042.16 0.00% 22736.35 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 118.80 73 164 45474.62 9473 155809 45483.65 32949 58649 5402042 5402042 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (7986) 0.0% (3.2%) 8.7 31.95s 276956 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.65 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 13669 3.2% 153.8 1.72s 15574 12195 Direct 152.9 12161 24295 15670 28.9%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.84 152.89 0.00 0.00 0.00 1.2770 0.0000 2395810.34 2395810.34 0.00% 12195.40 12195.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.08% 108.67 17 279 12161.09 7924 21116 12152.46 10793 14496 1321587 1321587 0.00%
crit 28.92% 44.22 6 136 24294.56 17784 42232 24279.01 21492 30244 1074223 1074223 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.400
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:16116.19
Hungering Shadowflame 4054 1.6% 17.4 16.51s 69742 0 Direct 17.4 54042 108160 69741 29.0%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.45 17.45 0.00 0.00 0.00 0.0000 0.0000 1216967.37 1216967.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.99% 12.39 3 27 54042.32 35869 210762 53850.89 36127 139332 669424 669424 0.00%
crit 29.01% 5.06 0 16 108160.33 71739 421524 107126.77 0 416939 547544 547544 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 3727 1.5% 34.6 8.50s 32333 0 Direct 34.5 25151 50265 32420 28.9%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.57 34.48 0.00 0.00 0.00 0.0000 0.0000 1117720.79 1117720.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.06% 24.50 9 50 25150.78 24387 28658 25150.64 24690 26383 616131 616131 0.00%
crit 28.94% 9.98 1 24 50264.55 48773 57316 50265.25 48773 53716 501590 501590 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21279.65
  • base_dd_max:21279.65
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 13339 5.4% 14.3 21.60s 278484 289624 Direct 14.3 9601 19687 13253 36.2%
Periodic 313.7 8678 18119 12133 36.6% 99.6%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.35 14.35 313.71 313.71 13.35 0.9616 0.9519 3996233.87 3996233.87 0.00% 12791.55 289624.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.78% 9.15 1 17 9600.71 6338 18341 9605.27 7956 12542 87879 87879 0.00%
crit 36.22% 5.20 0 13 19687.00 12519 35787 19655.78 0 31713 102310 102310 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.41% 198.92 127 269 8677.84 1138 15957 8681.98 8206 9278 1726176 1726176 0.00%
crit 36.59% 114.79 71 169 18119.22 2660 31913 18130.13 16800 19619 2079869 2079869 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.26
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.09
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (23588) 0.0% (9.5%) 17.0 17.92s 415617 352144

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.02 0.00 0.00 0.00 0.00 1.1803 0.0000 0.00 0.00 0.00% 352144.05 352144.05

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 8637 3.5% 5.3 62.49s 489539 267674 Direct 5.3 338182 662590 492277 47.5%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 5.28 0.00 0.00 0.00 1.8289 0.0000 2597238.25 2597238.25 0.00% 267673.74 267673.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.49% 2.77 0 6 338182.04 199460 571175 331401.88 0 541066 936531 936531 0.00%
crit 47.51% 2.51 0 6 662590.46 407513 1124154 637390.27 0 1060109 1660707 1660707 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.36
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 6402 2.6% 6.0 53.44s 318021 421513 Direct 6.0 206856 432734 319714 50.0%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.02 5.99 0.00 0.00 0.00 0.7545 0.0000 1913669.70 1913669.70 0.00% 421513.15 421513.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.03% 2.99 0 7 206855.62 102756 325842 203252.21 0 310847 619503 619503 0.00%
crit 49.97% 2.99 0 7 432734.28 201914 651683 428604.30 0 648320 1294166 1294166 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.03
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 8549 3.4% 5.7 57.80s 449877 370971 Direct 5.7 292558 583218 452135 54.9%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.69 5.66 0.00 0.00 0.00 1.2127 0.0000 2561553.11 2561553.11 0.00% 370970.76 370970.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 45.09% 2.55 0 7 292557.61 147712 466052 282525.16 0 458619 747262 747262 0.00%
crit 54.91% 3.11 0 7 583218.02 338356 936727 575645.07 0 905545 1814291 1814291 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.72
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (22074) 0.0% (8.9%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 8239 3.3% 96.1 3.10s 25699 0 Direct 95.8 17207 36116 25770 45.3%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.10 95.84 0.00 0.00 0.00 0.0000 0.0000 2469714.02 2469714.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.72% 52.44 26 91 17206.86 10130 34480 17211.85 15190 20204 902277 902277 0.00%
crit 45.28% 43.40 19 76 36116.22 20260 68960 36131.20 31720 44824 1567437 1567437 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 8248 3.3% 96.3 3.07s 25668 0 Direct 96.1 17184 36075 25738 45.3%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.34 96.08 0.00 0.00 0.00 0.0000 0.0000 2472900.94 2472900.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.72% 52.57 23 91 17184.12 10130 34480 17188.68 15140 19638 903387 903387 0.00%
crit 45.28% 43.51 17 74 36075.19 20260 68960 36091.36 31219 43289 1569514 1569514 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 5587 2.2% 6.4 47.15s 261177 0 Direct 6.4 174321 365704 261979 45.8%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.41 6.39 0.00 0.00 0.00 0.0000 0.0000 1675027.04 1675027.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.20% 3.47 0 9 174320.89 102287 342705 173084.08 0 320983 604066 604066 0.00%
crit 45.80% 2.93 0 8 365704.11 204574 676672 358040.98 0 652510 1070961 1070961 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 6048 2.4% 26.0 11.47s 69960 77633 Direct 27.0 47478 94816 67371 42.0%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.99 26.99 0.00 0.00 0.00 0.9012 0.0000 1818393.37 1818393.37 0.00% 77632.81 77632.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 57.98% 15.65 4 30 47477.54 20923 99911 47472.57 38081 55369 742989 742989 0.00%
crit 42.02% 11.34 2 24 94816.33 41846 193121 94785.19 63934 116769 1075405 1075405 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.04
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 80543 (108703) 32.3% (43.6%) 116.8 2.55s 278691 285268 Direct 116.5 (154.8) 141235 292770 206936 43.4% (43.9%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 116.80 116.55 0.00 0.00 0.00 0.9769 0.0000 24118188.48 24118188.48 0.00% 285267.95 285267.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.64% 66.02 36 98 141234.66 84731 274091 141304.13 130185 155563 9323935 9323935 0.00%
crit 43.36% 50.53 24 81 292770.30 165887 548182 292992.27 263717 334400 14794254 14794254 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:83.48
  • if_expr:variable.starsurge_condition1
    st
    [X]:33.32
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 28160 11.3% 38.4 7.68s 219331 0 Direct 38.3 148536 306121 220392 45.6%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.45 38.26 0.00 0.00 0.00 0.0000 0.0000 8432881.18 8432881.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.40% 20.82 5 45 148536.38 96832 286604 148599.17 124783 183255 3091754 3091754 0.00%
crit 45.60% 17.45 5 37 306120.64 193663 573209 306322.39 251711 392733 5341127 5341127 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 13364 5.4% 17.4 18.05s 230207 239655 Direct 17.4 9601 19436 13492 39.6%
Periodic 314.7 8561 17362 11987 38.9% 99.9%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.40 17.40 314.66 314.66 16.40 0.9606 0.9519 4006543.94 4006543.94 0.00% 12668.63 239654.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.43% 10.52 2 19 9600.77 5690 16674 9592.40 7975 12515 100983 100983 0.00%
crit 39.57% 6.89 1 16 19436.26 11381 33347 19438.77 11381 31026 133841 133841 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 61.08% 192.20 131 257 8561.23 222 15120 8560.48 8102 9070 1645455 1645455 0.00%
crit 38.92% 122.46 73 175 17362.37 6095 30240 17363.75 16170 18705 2126264 2126264 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.44
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.96
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (4315) 0.0% (1.7%) 8.6 31.54s 149882 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.64 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2247 0.9% 8.6 31.54s 78051 0 Direct 8.6 60493 120875 78053 29.1%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.64 8.64 0.00 0.00 0.00 0.0000 0.0000 674038.60 674038.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.92% 6.12 0 17 60493.49 58599 68863 60455.73 0 68863 370517 370517 0.00%
crit 29.08% 2.51 0 11 120875.18 117198 137726 112005.13 0 137726 303522 303522 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2068 0.8% 16.7 15.29s 37082 0 Direct 16.7 28768 57491 37083 28.9%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.73 16.73 0.00 0.00 0.00 0.0000 0.0000 620332.92 620332.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.05% 11.89 0 31 28767.87 27883 32767 28766.15 0 31161 341949 341949 0.00%
crit 28.95% 4.84 0 18 57490.93 55766 65534 56904.08 0 65534 278384 278384 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 23800 9.6% 117.9 2.49s 60461 64476 Direct 117.5 40250 83061 60691 47.7%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.95 117.50 0.00 0.00 0.00 0.9377 0.0000 7131136.05 7131136.05 0.00% 64475.65 64475.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.26% 61.40 35 91 40250.30 15445 126690 40257.28 35026 47365 2471398 2471398 0.00%
crit 47.74% 56.10 31 86 83060.55 30891 259088 83095.27 71868 94889 4659738 4659738 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:116.26

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
hissing_rune_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:hissing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:hissing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:hissing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 192.21s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 66.56s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.67 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:hissing_rune_3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:35466.09
  • base_dd_max:35466.09
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.33s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:hissing_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.5 307.29s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 49.20s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.07 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.07
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.9 1.4 35.4s 33.5s 8.4s 25.14% 29.13% 1.4 (7.0) 8.7

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.6s
  • trigger_min/max:2.6s / 49.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.17% / 27.78%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.91%
  • balance_of_all_things_arcane_2:2.95%
  • balance_of_all_things_arcane_3:3.01%
  • balance_of_all_things_arcane_4:3.04%
  • balance_of_all_things_arcane_5:3.07%
  • balance_of_all_things_arcane_6:3.31%
  • balance_of_all_things_arcane_7:3.42%
  • balance_of_all_things_arcane_8:3.43%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.4 3.0 16.6s 14.2s 8.3s 50.77% 54.75% 3.0 (17.9) 17.8

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.0s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.8s
  • uptime_min/max:45.60% / 54.93%

Stack Uptimes

  • balance_of_all_things_nature_1:5.96%
  • balance_of_all_things_nature_2:6.03%
  • balance_of_all_things_nature_3:6.13%
  • balance_of_all_things_nature_4:6.23%
  • balance_of_all_things_nature_5:6.36%
  • balance_of_all_things_nature_6:6.51%
  • balance_of_all_things_nature_7:6.66%
  • balance_of_all_things_nature_8:6.89%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.2 63.0 44.3s 4.1s 20.2s 48.60% 0.00% 35.1 (35.1) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.0s
  • trigger_min/max:0.8s / 42.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:42.88% / 55.00%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.61%
  • balance_t31_4pc_buff_lunar_2:4.35%
  • balance_t31_4pc_buff_lunar_3:4.89%
  • balance_t31_4pc_buff_lunar_4:5.60%
  • balance_t31_4pc_buff_lunar_5:29.15%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.0 102.8 22.0s 2.6s 19.3s 90.56% 0.00% 49.0 (49.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.1s
  • trigger_min/max:0.8s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:87.37% / 93.37%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.52%
  • balance_t31_4pc_buff_solar_2:11.48%
  • balance_t31_4pc_buff_solar_3:15.98%
  • balance_t31_4pc_buff_solar_4:11.67%
  • balance_t31_4pc_buff_solar_5:43.91%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.6s 70.6s 10.8s 10.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 339.5s
  • trigger_min/max:12.0s / 339.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 39.67%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.91%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 115.0s 70.6s 45.8s 33.36% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 354.6s
  • trigger_min/max:12.0s / 339.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 325.6s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.36%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.3s 70.3s 10.8s 10.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 332.5s
  • trigger_min/max:12.0s / 332.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.75%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.91%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.2s 70.3s 45.7s 33.31% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 357.8s
  • trigger_min/max:12.0s / 332.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 320.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.31%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.5s 70.5s 10.8s 9.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 335.2s
  • trigger_min/max:12.0s / 335.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 32.31%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.89%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.90%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.91%
  • best_friends_with_urctos_9:0.91%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.92%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.5s 70.5s 46.1s 33.33% 0.00% 69.1 (69.1) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 355.8s
  • trigger_min/max:12.0s / 335.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 318.0s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.33%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.7s 58.2s 49.8s 80.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 349.0s
  • trigger_min/max:15.0s / 338.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 351.5s
  • uptime_min/max:44.58% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.07%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.6 0.0 44.9s 31.6s 41.4s 57.79% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 272.2s
  • trigger_min/max:0.0s / 149.6s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 238.0s
  • uptime_min/max:20.98% / 96.53%

Stack Uptimes

  • denizen_of_the_dream_1:38.74%
  • denizen_of_the_dream_2:14.58%
  • denizen_of_the_dream_3:3.68%
  • denizen_of_the_dream_4:0.67%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.01%
  • denizen_of_the_dream_7:0.01%
  • denizen_of_the_dream_8:0.01%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.2 0.7 20.3s 20.6s 3.0s 15.30% 20.62% 0.7 (1.3) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.0s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.7s
  • uptime_min/max:8.43% / 26.74%

Stack Uptimes

  • dreamstate_1:9.47%
  • dreamstate_2:5.83%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.2 1.0 44.7s 44.3s 20.6s 49.60% 52.74% 1.0 (1.0) 6.9

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.2s
  • trigger_min/max:12.0s / 90.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.14% / 56.12%

Stack Uptimes

  • eclipse_lunar_1:49.60%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.9 5.5 22.3s 15.8s 20.1s 93.08% 96.25% 5.5 (5.5) 12.9

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.2s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.9s
  • uptime_min/max:90.69% / 95.08%

Stack Uptimes

  • eclipse_solar_1:93.08%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.0s 307.0s 27.3s 13.19% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.3s
  • trigger_min/max:300.0s / 328.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.89% / 18.03%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.19%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.3 3.4 55.1s 31.6s 25.0s 43.87% 43.82% 3.4 (3.4) 4.8

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 193.6s
  • trigger_min/max:0.0s / 149.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 152.1s
  • uptime_min/max:13.99% / 81.93%

Stack Uptimes

  • friend_of_the_fae_1:43.87%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.2 0.0 44.3s 44.3s 20.3s 48.70% 51.48% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.2s
  • trigger_min/max:12.0s / 90.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.39% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.70%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.0s 99.0s 19.5s 23.34% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 123.1s
  • trigger_min/max:90.0s / 123.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.39% / 26.36%

Stack Uptimes

  • kindled_soul_5:1.11%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.15%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.16%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.17%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.18%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.20%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.5s 20.5s 5.9s 25.51% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.5s
  • trigger_min/max:12.8s / 70.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.63% / 30.91%

Stack Uptimes

  • natures_grace_1:25.51%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.8s 18.43% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.9s
  • trigger_min/max:90.0s / 91.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.55% / 21.03%

Stack Uptimes

  • natures_vigil_1:18.43%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.1 73.7s 67.6s 7.7s 6.40% 7.09% 0.1 (0.1) 1.4

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.3s / 338.9s
  • trigger_min/max:0.0s / 338.9s
  • trigger_pct:15.00%
  • duration_min/max:0.0s / 32.5s
  • uptime_min/max:0.00% / 26.97%

Stack Uptimes

  • owlkin_frenzy_1:6.40%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.2 109.5 38.4s 38.4s 34.3s 94.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:23.8s / 50.0s
  • trigger_min/max:23.8s / 50.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.6s
  • uptime_min/max:90.85% / 96.88%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.01%
  • primordial_arcanic_pulsar_8:5.25%
  • primordial_arcanic_pulsar_12:6.72%
  • primordial_arcanic_pulsar_16:6.78%
  • primordial_arcanic_pulsar_20:6.59%
  • primordial_arcanic_pulsar_24:6.06%
  • primordial_arcanic_pulsar_28:6.92%
  • primordial_arcanic_pulsar_32:8.32%
  • primordial_arcanic_pulsar_36:6.61%
  • primordial_arcanic_pulsar_40:7.20%
  • primordial_arcanic_pulsar_44:7.33%
  • primordial_arcanic_pulsar_48:6.85%
  • primordial_arcanic_pulsar_52:7.70%
  • primordial_arcanic_pulsar_56:6.76%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.7 3.7 16.5s 14.2s 6.4s 39.69% 39.90% 3.7 (3.7) 18.3

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.4s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s
  • uptime_min/max:35.97% / 42.57%

Stack Uptimes

  • solstice_1:39.69%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 96.0 14.7s 2.6s 14.1s 97.33% 0.00% 54.9 (54.9) 7.6

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 19.9s
  • trigger_min/max:0.8s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.75% / 99.16%

Stack Uptimes

  • starlord_1:9.23%
  • starlord_2:14.77%
  • starlord_3:73.34%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.3 47.9s 5.5s 43.2s 90.17% 0.00% 54.5 (54.5) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:482.27

Trigger Details

  • interval_min/max:10.0s / 320.0s
  • trigger_min/max:5.0s / 35.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 347.9s
  • uptime_min/max:73.08% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.17%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 60.9s 45.5s 16.5s 23.64% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 228.9s
  • trigger_min/max:0.0s / 228.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 82.3s
  • uptime_min/max:4.65% / 58.24%

Stack Uptimes

  • wafting_devotion_1:23.64%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 49.2s 49.2s 21.7s 43.82% 42.93% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.0s
  • trigger_min/max:45.0s / 82.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.18% / 51.53%

Stack Uptimes

  • warrior_of_elune_1:20.39%
  • warrior_of_elune_2:5.26%
  • warrior_of_elune_3:18.17%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.7 2.0 24.0 31.6s 0.0s 149.6s
Primordial Arcanic Pulsar 7.3 6.0 9.0 40.0s 28.3s 49.8s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 2.03% 0.4s 0.0s 2.8s
Astral Smolder 79.41% 59.59% 93.36% 15.6s 0.0s 132.0s
Incarnation (Total) 48.70% 43.39% 55.00% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 28.46% 26.42% 30.96% 11.7s 0.0s 12.0s
Lunar Eclipse Only 0.91% 0.71% 1.12% 2.7s 2.5s 2.7s
Solar Eclipse Only 44.38% 36.17% 50.82% 11.0s 0.0s 15.0s
No Eclipse 5.99% 3.81% 8.21% 1.4s 0.0s 3.5s
Friend of the Fae 43.87% 13.99% 81.93% 25.0s 0.0s 152.1s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.8220.00037.02347.57525.97769.046
Full Moon
New Moon
Half Moon
0.3410.00027.0085.8045.28732.559

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.124.4%57.9049.9%0.000.0%52.9345.7%
Starfire24.9892.6%0.000.0%2.007.4%0.010.0%
Starsurge0.000.0%46.6840.0%0.000.0%70.1260.0%
New Moon0.020.4%0.264.4%0.000.0%5.7395.3%
Half Moon0.000.0%0.345.9%0.000.0%5.3694.1%
Full Moon0.201.7%3.0926.4%0.080.7%8.3471.2%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
hissing_rune_3
Nature's BalanceAstral Power99.52198.935.41%2.000.100.05%
Full MoonAstral Power5.31264.897.20%49.930.360.14%
Half MoonAstral Power5.69136.663.71%24.000.000.00%
MoonfireAstral Power14.3586.032.34%6.000.070.08%
New MoonAstral Power6.0272.211.96%12.000.000.00%
Orbit BreakerAstral Power6.41191.325.20%29.831.070.56%
Shooting Stars (Moonfire)Astral Power96.10192.005.22%2.000.200.10%
Shooting Stars (Sunfire)Astral Power96.34192.485.23%2.000.200.10%
StarfireAstral Power26.99395.4310.75%14.652.920.73%
SunfireAstral Power17.40104.412.84%6.000.010.01%
WrathAstral Power117.951844.4450.14%15.640.000.00%
Usage Type Count Total Tot% Avg RPE APR
hissing_rune_3
StarsurgeAstral Power 116.983690.89100.00%31.5531.608819.29
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896040.0 4139.85 4936.05 1752769.6 657143.7 -486272.6 896040.0
Astral Power 70.0 12.26 12.28 4.9 23.6 0.0 100.0
Created with Highcharts 4.2.3hissing_rune_3 Astral Power Gainswrath: 1844.4starfire: 395.4full_moon: 264.9Natures Balance: 198.9shooting_stars_sunfire: 192.5shooting_stars_moonfire: 192.0orbit_breaker: 191.3half_moon: 136.7sunfire: 104.4moonfire: 86.0new_moon: 72.2
Created with Highcharts 4.2.3Time (seconds)Average Astral Powerhissing_rune_3 Astral Power0100200300050100

Statistics & Data Analysis

Fight Length
hissing_rune_3 Fight Length
Count 20545
Mean 300.04
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 34.5478
5th Percentile 246.28
95th Percentile 353.97
( 95th Percentile - 5th Percentile ) 107.70
Mean Distribution
Standard Deviation 0.2410
95.00% Confidence Interval ( 299.57 - 300.52 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 510
0.1% Error 50929
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1019
DPS
hissing_rune_3 Damage Per Second
Count 20545
Mean 249024.26
Minimum 215575.13
Maximum 289438.56
Spread ( max - min ) 73863.42
Range [ ( max - min ) / 2 * 100% ] 14.83%
Standard Deviation 9092.0764
5th Percentile 234724.55
95th Percentile 264510.57
( 95th Percentile - 5th Percentile ) 29786.02
Mean Distribution
Standard Deviation 63.4322
95.00% Confidence Interval ( 248899.93 - 249148.58 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5121
0.1 Scale Factor Error with Delta=300 705684
0.05 Scale Factor Error with Delta=300 2822734
0.01 Scale Factor Error with Delta=300 70568328
Priority Target DPS
hissing_rune_3 Priority Target Damage Per Second
Count 20545
Mean 249024.26
Minimum 215575.13
Maximum 289438.56
Spread ( max - min ) 73863.42
Range [ ( max - min ) / 2 * 100% ] 14.83%
Standard Deviation 9092.0764
5th Percentile 234724.55
95th Percentile 264510.57
( 95th Percentile - 5th Percentile ) 29786.02
Mean Distribution
Standard Deviation 63.4322
95.00% Confidence Interval ( 248899.93 - 249148.58 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5121
0.1 Scale Factor Error with Delta=300 705684
0.05 Scale Factor Error with Delta=300 2822734
0.01 Scale Factor Error with Delta=300 70568328
DPS(e)
hissing_rune_3 Damage Per Second (Effective)
Count 20545
Mean 249024.26
Minimum 215575.13
Maximum 289438.56
Spread ( max - min ) 73863.42
Range [ ( max - min ) / 2 * 100% ] 14.83%
Damage
hissing_rune_3 Damage
Count 20545
Mean 72224581.79
Minimum 53216405.22
Maximum 91750918.91
Spread ( max - min ) 38534513.69
Range [ ( max - min ) / 2 * 100% ] 26.68%
DTPS
hissing_rune_3 Damage Taken Per Second
Count 20545
Mean 4936.37
Minimum 999.36
Maximum 10053.63
Spread ( max - min ) 9054.27
Range [ ( max - min ) / 2 * 100% ] 91.71%
HPS
hissing_rune_3 Healing Per Second
Count 20545
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
hissing_rune_3 Healing Per Second (Effective)
Count 20545
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
hissing_rune_3 Heal
Count 20545
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
hissing_rune_3 Healing Taken Per Second
Count 20545
Mean 4126.78
Minimum 735.36
Maximum 8191.51
Spread ( max - min ) 7456.15
Range [ ( max - min ) / 2 * 100% ] 90.34%
TMI
hissing_rune_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
hissing_rune_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
hissing_rune_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.60 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.44 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.26 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.07 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.04 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 83.48 starsurge,if=variable.starsurge_condition1
R 15.96 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.09 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.03 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.72 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.36 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.18 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 33.32 starsurge,if=variable.starsurge_condition2
Y 116.26 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVQYYXRYYXYSWQQQYYYYXXYXTOYXQYYYWQQQRYYYYXYSXYYXXYPPQQYRQYYYYYXXPPQSYQUQRYQVOXXYWYQPPQQYYQSYRYYXWQFYYPPQQYQYYYYRWQQESQTUQYQYYXYXOPPWQQRYQYYSYYXYXYPPQQYYQRYYYXYXVSQQQTYYRPPQQYYYWQQYOYQSYYXRPPXYYQFQYQYYYYXYXUSRYWQQEQVXYYNQQYTYYXYYQQQRSYYYXYYXYYWQQOQUQQRYQYYYYSWQQQYYXYYPPQQRYYYWQQYYQYSPPQYYYRWQQQVFQOQTYXYXYXPPQRSQYYQYYYYXYWQPPQYQRSYYYXYYWQEQUQQVOYRXXYPPWQQQSDYQYYYYXYRWQPPQYQYYQSTUYWQQYQRY

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask hissing_rune_3 50.0/100: 50% astral_power
Pre precombat 1 food hissing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation hissing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent hissing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket hissing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket hissing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket hissing_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil hissing_rune_3 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.925 st K moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.850 st L starfire Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.682 st N incarnation_chosen_of_elune Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.682 default D potion Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage
0:02.682 default E use_items Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:02.682 st Q starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.522 st Q starsurge Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.333 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.087 st T new_moon Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.841 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.595 st U half_moon Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.522 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.277 st V full_moon Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.667 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:10.422 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:11.177 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.932 st X starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.685 st R sunfire Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.439 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:14.195 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.949 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.702 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.455 st S moonfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:17.211 st W cancel_buff Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.211 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.991 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:18.746 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.501 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.256 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:21.010 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.764 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.518 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.274 st X starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:24.028 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:24.782 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:25.536 st T new_moon Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.303 st O warrior_of_elune Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.303 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.058 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.812 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.566 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.320 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.076 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.831 st W cancel_buff Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.831 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.671 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.480 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:33.259 st R sunfire Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:34.014 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:34.768 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:35.522 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:36.276 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:37.030 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:37.786 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:38.542 st S moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:39.296 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:40.052 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:41.031 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:42.006 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:42.981 st X starsurge Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:43.956 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak
0:44.931 st P starfire Fluffy_Pillow 40.0/100: 40% astral_power natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak
0:45.687 st P starfire Fluffy_Pillow 60.8/100: 61% astral_power natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, undulating_sporecloak
0:46.440 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak
0:47.532 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
0:48.583 st Y wrath Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
0:49.595 st R sunfire Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
0:50.606 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
0:51.618 st Y wrath Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_nature(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
0:52.692 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:53.765 st Y wrath Fluffy_Pillow 37.6/100: 38% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:54.839 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:55.913 st Y wrath Fluffy_Pillow 73.6/100: 74% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
0:56.986 st X starsurge Fluffy_Pillow 89.6/100: 90% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
0:58.060 st X starsurge Fluffy_Pillow 57.6/100: 58% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak
0:59.133 st P starfire Fluffy_Pillow 23.6/100: 24% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak
1:00.743 st P starfire Fluffy_Pillow 37.6/100: 38% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak
1:01.620 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, dreamstate, best_friends_with_pip_static, undulating_sporecloak
1:02.714 st S moonfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip_static, undulating_sporecloak
1:03.766 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
1:04.520 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
1:05.569 st U half_moon Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak
1:06.794 st Q starsurge Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak
1:07.806 st R sunfire Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak
1:08.781 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
1:09.684 st Q starsurge Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
1:10.587 st V full_moon Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:12.391 st O warrior_of_elune Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:12.391 st X starsurge Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:13.294 st X starsurge Fluffy_Pillow 35.6/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:14.199 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:15.104 st W cancel_buff Fluffy_Pillow 27.6/100: 28% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:15.104 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:16.116 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:17.128 st P starfire Fluffy_Pillow 15.6/100: 16% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord, warrior_of_elune(3), dreamstate, best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:17.884 st P starfire Fluffy_Pillow 32.4/100: 32% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord, warrior_of_elune(2), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:18.637 st Q starsurge Fluffy_Pillow 83.2/100: 83% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, warrior_of_elune, best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:19.610 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:20.546 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:21.452 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:22.358 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:23.262 st S moonfire Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:24.336 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:25.410 st R sunfire Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:26.483 st Y wrath Fluffy_Pillow 51.2/100: 51% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:27.557 st Y wrath Fluffy_Pillow 69.2/100: 69% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:28.629 st X starsurge Fluffy_Pillow 85.2/100: 85% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:29.703 st W cancel_buff Fluffy_Pillow 49.2/100: 49% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:29.703 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power eclipse_solar, primordial_arcanic_pulsar(36), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:30.905 default F natures_vigil hissing_rune_3 17.2/100: 17% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:30.905 st Y wrath Fluffy_Pillow 17.2/100: 17% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(40), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:32.060 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:33.216 st P starfire Fluffy_Pillow 49.2/100: 49% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord, warrior_of_elune, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:33.969 st P starfire Fluffy_Pillow 66.0/100: 66% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord, warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:34.723 st Q starsurge Fluffy_Pillow 84.8/100: 85% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:35.774 st Q starsurge Fluffy_Pillow 48.8/100: 49% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:36.785 st Y wrath Fluffy_Pillow 16.8/100: 17% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:37.760 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:38.735 st Y wrath Fluffy_Pillow 0.8/100: 1% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:39.712 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:40.787 st Y wrath Fluffy_Pillow 40.8/100: 41% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:41.862 st Y wrath Fluffy_Pillow 58.8/100: 59% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:42.937 st R sunfire Fluffy_Pillow 78.8/100: 79% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:43.930 st W cancel_buff Fluffy_Pillow 84.8/100: 85% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:43.930 st Q starsurge Fluffy_Pillow 84.8/100: 85% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:45.044 st Q starsurge Fluffy_Pillow 52.8/100: 53% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:46.114 default E use_items Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:46.114 st S moonfire Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
1:47.051 st Q starsurge Fluffy_Pillow 28.8/100: 29% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
1:47.989 st T new_moon Fluffy_Pillow 0.8/100: 1% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(95)
1:48.743 st U half_moon Fluffy_Pillow 16.8/100: 17% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(90)
1:49.946 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(85)
1:50.850 st Y wrath Fluffy_Pillow 18.8/100: 19% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(80)
1:51.755 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(75)
1:52.659 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(70)
1:53.564 st Y wrath Fluffy_Pillow 28.8/100: 29% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(65)
1:54.469 st X starsurge Fluffy_Pillow 46.8/100: 47% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(60)
1:55.372 st Y wrath Fluffy_Pillow 18.8/100: 19% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(55)
1:56.276 st X starsurge Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(50)
1:57.180 st O warrior_of_elune Fluffy_Pillow 8.8/100: 9% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(45)
1:57.391 st P starfire Fluffy_Pillow 8.8/100: 9% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(45)
1:58.145 st P starfire Fluffy_Pillow 25.6/100: 26% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
1:58.899 st W cancel_buff Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
1:58.899 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune(2), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
1:59.992 st Q starsurge Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
2:01.043 st R sunfire Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
2:02.056 st Y wrath Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
2:03.066 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
2:04.180 st Y wrath Fluffy_Pillow 4.4/100: 4% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
2:05.256 st Y wrath Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
2:06.330 st S moonfire Fluffy_Pillow 40.4/100: 40% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:07.402 st Y wrath Fluffy_Pillow 48.4/100: 48% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:08.477 st Y wrath Fluffy_Pillow 64.4/100: 64% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak
2:09.550 st X starsurge Fluffy_Pillow 82.4/100: 82% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak
2:10.623 st Y wrath Fluffy_Pillow 46.4/100: 46% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak
2:11.697 st X starsurge Fluffy_Pillow 62.4/100: 62% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak
2:12.772 st Y wrath Fluffy_Pillow 28.4/100: 28% astral_power denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak
2:13.845 st P starfire Fluffy_Pillow 40.4/100: 40% astral_power denizen_of_the_dream, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
2:14.597 st P starfire Fluffy_Pillow 57.2/100: 57% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(40), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak
2:15.354 st Q starsurge Fluffy_Pillow 76.0/100: 76% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak
2:16.448 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak
2:17.498 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
2:18.511 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
2:19.523 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
2:20.637 st R sunfire Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:21.712 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:22.786 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:23.858 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:24.930 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:26.004 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static
2:27.079 st X starsurge Fluffy_Pillow 58.0/100: 58% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static
2:28.153 st V full_moon Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
2:30.100 st S moonfire Fluffy_Pillow 76.0/100: 76% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
2:31.077 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static
2:32.168 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static
2:33.219 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static
2:34.232 st T new_moon Fluffy_Pillow 4.0/100: 4% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static
2:34.987 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static
2:35.961 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak
2:36.935 st R sunfire Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak
2:37.912 st P starfire Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak
2:39.375 st P starfire Fluffy_Pillow 78.0/100: 78% astral_power natures_grace, primordial_arcanic_pulsar(12), starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:40.254 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:41.228 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:42.203 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:42.957 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:43.933 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:44.910 st W cancel_buff Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:44.910 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:46.003 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), solstice, starlord, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:47.159 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:48.273 st O warrior_of_elune Fluffy_Pillow 22.0/100: 22% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:48.273 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:49.385 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:50.498 st S moonfire Fluffy_Pillow 4.0/100: 4% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:51.572 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:52.645 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:53.721 st X starsurge Fluffy_Pillow 46.0/100: 46% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:54.794 st R sunfire Fluffy_Pillow 14.0/100: 14% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:55.867 st P starfire Fluffy_Pillow 52.0/100: 52% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:56.622 st P starfire Fluffy_Pillow 68.8/100: 69% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:57.376 st X starsurge Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:58.351 st Y wrath Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:59.256 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:00.161 st Q starsurge Fluffy_Pillow 93.6/100: 94% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:01.172 default F natures_vigil hissing_rune_3 57.6/100: 58% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:01.172 st Q starsurge Fluffy_Pillow 57.6/100: 58% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:02.146 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:03.179 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:04.211 st Y wrath Fluffy_Pillow 7.6/100: 8% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:05.206 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:06.201 st Y wrath Fluffy_Pillow 41.6/100: 42% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:07.195 st Y wrath Fluffy_Pillow 57.6/100: 58% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:08.190 st X starsurge Fluffy_Pillow 75.6/100: 76% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:09.183 st Y wrath Fluffy_Pillow 41.6/100: 42% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:10.177 st X starsurge Fluffy_Pillow 59.6/100: 60% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:11.172 st U half_moon Fluffy_Pillow 23.6/100: 24% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:12.376 st S moonfire Fluffy_Pillow 51.6/100: 52% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:13.281 st R sunfire Fluffy_Pillow 59.6/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:14.185 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:15.090 st W cancel_buff Fluffy_Pillow 87.6/100: 88% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:15.090 st Q starsurge Fluffy_Pillow 87.6/100: 88% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:16.104 st Q starsurge Fluffy_Pillow 61.6/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:17.076 default E use_items Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
3:17.076 st Q starsurge Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage, kindled_soul(100)
3:18.087 st V full_moon Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage, kindled_soul(95)
3:20.034 st X starsurge Fluffy_Pillow 57.6/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
3:21.011 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
3:21.985 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
3:22.958 st N incarnation_chosen_of_elune Fluffy_Pillow 57.6/100: 58% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
3:22.958 st Q starsurge Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
3:23.848 st Q starsurge Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
3:24.735 st Y wrath Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
3:25.488 st T new_moon Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
3:26.305 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
3:27.060 st Y wrath Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
3:27.947 st X starsurge Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
3:28.833 st Y wrath Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
3:29.808 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
3:30.783 st Q starsurge Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
3:31.876 st Q starsurge Fluffy_Pillow 61.6/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
3:32.925 st Q starsurge Fluffy_Pillow 33.6/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
3:33.937 st R sunfire Fluffy_Pillow 9.6/100: 10% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
3:34.913 st S moonfire Fluffy_Pillow 17.6/100: 18% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
3:35.889 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
3:36.865 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
3:37.840 st Y wrath Fluffy_Pillow 59.6/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:38.816 st X starsurge Fluffy_Pillow 75.6/100: 76% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:39.791 st Y wrath Fluffy_Pillow 49.6/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:40.767 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:41.742 st X starsurge Fluffy_Pillow 81.6/100: 82% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:42.646 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:43.551 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:44.455 st W cancel_buff Fluffy_Pillow 89.6/100: 90% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:44.455 st Q starsurge Fluffy_Pillow 89.6/100: 90% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:45.467 st Q starsurge Fluffy_Pillow 63.6/100: 64% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:46.439 st O warrior_of_elune Fluffy_Pillow 35.6/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:46.439 st Q starsurge Fluffy_Pillow 35.6/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:47.377 st U half_moon Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:48.582 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:49.486 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:50.389 st R sunfire Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:51.294 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:52.199 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:53.104 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:54.007 st Y wrath Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:54.911 st Y wrath Fluffy_Pillow 53.6/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:55.818 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:56.721 st S moonfire Fluffy_Pillow 85.6/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:57.625 st W cancel_buff Fluffy_Pillow 95.6/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:57.625 st Q starsurge Fluffy_Pillow 95.6/100: 96% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:58.638 st Q starsurge Fluffy_Pillow 67.6/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:59.613 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:00.552 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:01.457 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:02.361 st X starsurge Fluffy_Pillow 49.6/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:03.266 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:04.170 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:05.076 st P starfire Fluffy_Pillow 49.6/100: 50% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:05.832 st P starfire Fluffy_Pillow 66.4/100: 66% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:06.587 st Q starsurge Fluffy_Pillow 89.2/100: 89% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, corrupting_rage
4:07.562 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:08.465 st R sunfire Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:09.369 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
4:10.273 st Y wrath Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:11.179 st Y wrath Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:12.174 st W cancel_buff Fluffy_Pillow 85.2/100: 85% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:12.174 st Q starsurge Fluffy_Pillow 85.2/100: 85% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:13.286 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
4:14.356 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
4:15.388 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
4:16.420 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
4:17.452 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
4:18.446 st S moonfire Fluffy_Pillow 29.2/100: 29% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
4:19.439 st P starfire Fluffy_Pillow 35.2/100: 35% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
4:20.927 st P starfire Fluffy_Pillow 51.2/100: 51% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(48), starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
4:21.742 st Q starsurge Fluffy_Pillow 65.2/100: 65% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak
4:22.718 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
4:23.472 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
4:24.449 st Y wrath Fluffy_Pillow 65.2/100: 65% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
4:25.424 st R sunfire Fluffy_Pillow 83.2/100: 83% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
4:26.401 st W cancel_buff Fluffy_Pillow 93.2/100: 93% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
4:26.401 st Q starsurge Fluffy_Pillow 93.2/100: 93% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
4:27.493 st Q starsurge Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
4:28.651 st Q starsurge Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:29.664 st V full_moon Fluffy_Pillow 5.2/100: 5% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:31.612 default F natures_vigil hissing_rune_3 59.2/100: 59% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:31.612 st Q starsurge Fluffy_Pillow 59.2/100: 59% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:32.590 st O warrior_of_elune Fluffy_Pillow 31.2/100: 31% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:32.590 st Q starsurge Fluffy_Pillow 31.2/100: 31% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:33.564 st T new_moon Fluffy_Pillow 7.2/100: 7% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:34.318 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:35.292 st X starsurge Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:36.267 st Y wrath Fluffy_Pillow 45.2/100: 45% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:37.242 st X starsurge Fluffy_Pillow 61.2/100: 61% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:38.217 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:39.194 st X starsurge Fluffy_Pillow 51.2/100: 51% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:40.168 st P starfire Fluffy_Pillow 23.2/100: 23% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:40.924 st P starfire Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:41.679 st Q starsurge Fluffy_Pillow 58.8/100: 59% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:42.771 st R sunfire Fluffy_Pillow 26.8/100: 27% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:43.821 st S moonfire Fluffy_Pillow 34.8/100: 35% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:44.871 st Q starsurge Fluffy_Pillow 40.8/100: 41% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:45.922 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:47.036 st Y wrath Fluffy_Pillow 28.8/100: 29% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:48.148 st Q starsurge Fluffy_Pillow 46.8/100: 47% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:49.261 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:50.333 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:51.405 st Y wrath Fluffy_Pillow 48.8/100: 49% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:52.478 st Y wrath Fluffy_Pillow 64.8/100: 65% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:53.550 st X starsurge Fluffy_Pillow 80.8/100: 81% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:54.623 st Y wrath Fluffy_Pillow 46.8/100: 47% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:55.697 st W cancel_buff Fluffy_Pillow 62.8/100: 63% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:55.697 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:56.898 st P starfire Fluffy_Pillow 28.8/100: 29% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord, warrior_of_elune, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:57.653 st P starfire Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:58.599 st Q starsurge Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:59.648 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:00.657 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:01.668 st R sunfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:02.643 st S moonfire Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:03.716 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:04.790 st Y wrath Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:05.863 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:06.937 st X starsurge Fluffy_Pillow 85.6/100: 86% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:08.011 st Y wrath Fluffy_Pillow 49.6/100: 50% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:09.085 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:10.158 st W cancel_buff Fluffy_Pillow 85.6/100: 86% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:10.158 st Q starsurge Fluffy_Pillow 85.6/100: 86% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), balance_t31_4pc_buff_solar(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:11.358 default E use_items Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
5:11.358 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
5:12.408 st U half_moon Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
5:13.757 st Q starsurge Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
5:14.768 st Q starsurge Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
5:15.743 st V full_moon Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
5:17.692 st O warrior_of_elune Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
5:17.692 st Y wrath Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
5:18.669 st R sunfire Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
5:19.644 st X starsurge Fluffy_Pillow 85.6/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
5:20.620 st X starsurge Fluffy_Pillow 57.6/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
5:21.595 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
5:22.570 st P starfire Fluffy_Pillow 41.6/100: 42% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
5:23.325 st P starfire Fluffy_Pillow 58.4/100: 58% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
5:24.077 st W cancel_buff Fluffy_Pillow 77.2/100: 77% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
5:24.077 st Q starsurge Fluffy_Pillow 77.2/100: 77% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
5:25.167 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
5:26.217 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
5:27.228 st S moonfire Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
5:28.203 default D potion Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
5:28.203 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
5:29.276 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
5:30.348 st Y wrath Fluffy_Pillow 5.2/100: 5% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
5:31.423 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:32.497 st Y wrath Fluffy_Pillow 39.2/100: 39% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:33.570 st Y wrath Fluffy_Pillow 57.2/100: 57% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:34.643 st X starsurge Fluffy_Pillow 75.2/100: 75% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:35.716 st Y wrath Fluffy_Pillow 39.2/100: 39% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:36.789 st R sunfire Fluffy_Pillow 57.2/100: 57% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:37.863 st W cancel_buff Fluffy_Pillow 65.2/100: 65% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:37.863 st Q starsurge Fluffy_Pillow 65.2/100: 65% astral_power eclipse_solar, primordial_arcanic_pulsar(40), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:39.065 st P starfire Fluffy_Pillow 31.2/100: 31% astral_power natures_grace, primordial_arcanic_pulsar(44), starlord, warrior_of_elune, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:39.818 st P starfire Fluffy_Pillow 48.0/100: 48% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:40.764 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:41.814 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:42.825 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:43.837 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:44.814 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:45.887 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:46.960 st S moonfire Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:48.034 st T new_moon Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:48.789 st U half_moon Fluffy_Pillow 36.0/100: 36% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:50.218 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
5:51.291 st W cancel_buff Fluffy_Pillow 78.0/100: 78% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
5:51.291 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
5:52.491 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
5:53.540 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
5:54.551 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
5:55.561 st R sunfire Fluffy_Pillow 12.0/100: 12% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, elemental_potion_of_ultimate_power
5:56.534 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power

Stats

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 489, stats: { 617 Armor, +2975 Sta, +230 Haste, +545 Vers, +704 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 489, stats: { 449 Armor, +2231 Sta, +228 Crit, +353 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 489, stats: { 505 Armor, +2975 Sta, +354 Haste, +421 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 486, stats: { 351 Armor, +2156 Sta, +304 Vers, +271 Mastery, +513 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="hissing_rune_3"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:hissing_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=489
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=486
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=489,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38981
# gear_intellect=12117
# gear_crit_rating=3151
# gear_haste_rating=4085
# gear_mastery_rating=7622
# gear_versatility_rating=849
# gear_armor=5330
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

howling_rune_3 : 248999 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
248999.0 248999.0 124.2 / 0.050% 35438.9 / 14.2% 19356.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.4 12.4 Astral Power 0.00% 68.1 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Created with Highcharts 4.2.3Time (seconds)Damage per secondhowling_rune_3 Damage per second01002003000k250k500k
Created with Highcharts 4.2.3Damage per Execute Timehowling_rune_3 Damage per Execute Timenew_moonhalf_moonmoons_talentmoonfirestarsurgefull_moonsunfirestarfirewrath0k50k100k150k200k250k300k350k400k4…450k
Created with Highcharts 4.2.3howling_rune_3 Damage Sourcesstarsurge: 32.2%goldrinns_fang: 11.3%wrath: 9.7%astral_smolder: 7.3%sunfire: 5.4%moonfire: 5.4%full_moon: 3.4%half_moon: 3.4%shooting_stars_sunfire: 3.3%shooting_stars_moonfire: 3.3%fey_missile: 3.3%new_moon: 2.5%starfire: 2.4%orbit_breaker: 2.3%hungering_shadowflame: 1.7%launched_thorns: 1.5%denizen_of_the_flame: 0.9%denizen_of_the_flame_secondary: 0.8%
Created with Highcharts 4.2.3# Iterationshowling_rune_3 DPS Distributionmin=215013mean=248999max=286…max=286376050010001500
Created with Highcharts 4.2.3Time (seconds)Damage taken per secondhowling_rune_3 Damage taken per second01002003000k2.5k5k7.5k
Created with Highcharts 4.2.3howling_rune_3 Spent Timestarsurge: 113.9swrath: 111.6sstarfire: 23.1smoons_talent: 19.9ssunfire: 16.5smoonfire: 13.6sfull_moon: 9.6shalf_moon: 6.9snew_moon: 4.5s

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
howling_rune_3 248999
Astral Smolder 18112 7.3% 68.5 4.33s 79174 0 Periodic 119.6 45333 0 45333 0.0% 79.8%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.50 0.00 119.63 119.63 53.49 0.0000 2.0000 5423133.26 5423133.26 0.00% 22666.75 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 119.63 76 163 45332.73 9413 153547 45343.24 33597 58883 5423133 5423133 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (8135) 0.0% (3.3%) 8.8 30.98s 277102 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.80 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 13759 3.3% 158.4 1.65s 15389 12225 Direct 157.5 12015 23999 15483 28.9%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 158.43 157.45 0.00 0.00 0.00 1.2588 0.0000 2437968.04 2437968.04 0.00% 12224.80 12224.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.05% 111.88 20 281 12014.52 8782 20854 12003.76 10664 13933 1344166 1344166 0.00%
crit 28.95% 45.58 7 122 23998.87 17563 41255 23982.39 20953 29888 1093802 1093802 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.435
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:18526.19
Hungering Shadowflame 4130 1.7% 17.7 16.27s 69942 0 Direct 17.7 54133 108782 69939 28.9%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.72 17.72 0.00 0.00 0.00 0.0000 0.0000 1239065.85 1239065.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.08% 12.59 2 27 54133.28 35869 210762 53978.90 36256 131914 681647 681647 0.00%
crit 28.92% 5.12 0 17 108782.47 71739 421524 107861.15 0 398566 557419 557419 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31299.68
  • base_dd_max:31299.68
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 3774 1.5% 35.0 8.36s 32323 0 Direct 34.9 25152 50266 32414 28.9%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.99 34.89 0.00 0.00 0.00 0.0000 0.0000 1131028.77 1131028.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.08% 24.80 9 50 25152.02 24387 28658 25151.73 24706 26507 623840 623840 0.00%
crit 28.92% 10.09 0 26 50266.15 48773 57316 50262.79 0 54090 507189 507189 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21279.65
  • base_dd_max:21279.65
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 13436 5.4% 14.4 21.59s 280267 294924 Direct 14.4 9576 19658 13285 36.8%
Periodic 318.2 8610 17991 12042 36.6% 99.5%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.35 14.35 318.17 318.17 13.35 0.9504 0.9378 4022177.80 4022177.80 0.00% 12890.36 294924.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.21% 9.07 1 17 9575.77 7011 18165 9582.60 7243 13231 86866 86866 0.00%
crit 36.79% 5.28 0 14 19658.06 12597 35935 19631.58 0 31977 103797 103797 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.41% 201.76 135 273 8609.85 1663 15804 8613.84 8104 9234 1737119 1737119 0.00%
crit 36.59% 116.41 67 179 17990.95 885 31608 18001.95 16564 19559 2094396 2094396 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.30
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.05
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (23276) 0.0% (9.4%) 17.0 17.89s 409446 351179

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.03 0.00 0.00 0.00 0.00 1.1659 0.0000 0.00 0.00 0.00% 351178.74 351178.74

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 8556 3.4% 5.3 62.04s 483217 268219 Direct 5.3 333698 653855 486161 47.6%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.32 5.29 0.00 0.00 0.00 1.8017 0.0000 2570072.98 2570072.98 0.00% 268218.85 268218.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.38% 2.77 0 6 333697.96 199874 563195 326486.11 0 533507 923903 923903 0.00%
crit 47.62% 2.52 0 6 653855.27 398007 1108369 628751.63 0 1077228 1646170 1646170 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.37
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 6270 2.5% 6.0 53.25s 311281 412611 Direct 6.0 202421 424700 312867 49.7%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.02 5.99 0.00 0.00 0.00 0.7545 0.0000 1872840.94 1872840.94 0.00% 412610.91 412610.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 50.31% 3.01 0 7 202421.49 100807 316074 198657.82 0 305010 609652 609652 0.00%
crit 49.69% 2.97 0 7 424699.72 210284 639263 420805.37 0 639263 1263189 1263189 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.03
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 8451 3.4% 5.7 57.54s 444248 369513 Direct 5.7 289798 574836 446572 55.0%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.70 5.67 0.00 0.00 0.00 1.2023 0.0000 2530793.51 2530793.51 0.00% 369512.85 369512.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 45.00% 2.55 0 7 289797.79 169545 459541 279527.62 0 445569 738945 738945 0.00%
crit 55.00% 3.12 0 7 574836.12 317112 924870 567046.47 0 877949 1791848 1791848 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.72
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (22134) 0.0% (8.9%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 8256 3.3% 97.5 3.05s 25360 0 Direct 97.3 16936 35636 25431 45.4%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.53 97.26 0.00 0.00 0.00 0.0000 0.0000 2473323.43 2473323.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.58% 53.08 22 91 16935.91 9937 33465 16942.08 14892 19863 898988 898988 0.00%
crit 45.42% 44.18 18 76 35636.34 19874 67673 35654.51 30237 41287 1574335 1574335 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 8278 3.3% 97.9 3.05s 25325 0 Direct 97.7 16915 35590 25395 45.4%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.93 97.66 0.00 0.00 0.00 0.0000 0.0000 2480129.53 2480129.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.59% 53.32 23 93 16914.64 9937 33998 16919.72 14530 19795 901868 901868 0.00%
crit 45.41% 44.34 16 73 35590.19 19874 67997 35608.75 31071 41153 1578262 1578262 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 5599 2.3% 6.5 46.60s 257688 0 Direct 6.5 171336 361404 258513 45.9%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.51 6.49 0.00 0.00 0.00 0.0000 0.0000 1677681.01 1677681.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.14% 3.51 0 8 171336.17 101621 343300 170058.35 0 320883 602039 602039 0.00%
crit 45.86% 2.98 0 8 361404.49 200676 653643 354067.73 0 634330 1075642 1075642 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 5918 2.4% 25.7 11.64s 69230 77120 Direct 26.7 46980 93884 66638 41.9%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.70 26.70 0.00 0.00 0.00 0.8977 0.0000 1779168.23 1779168.23 0.00% 77120.43 77120.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.09% 15.51 4 28 46979.72 20723 88428 46955.44 37201 56732 728593 728593 0.00%
crit 41.91% 11.19 1 24 93883.55 41446 176524 93810.62 53535 117972 1050575 1050575 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:24.75
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 80136 (108220) 32.2% (43.4%) 118.0 2.53s 274302 284369 Direct 117.8 (156.5) 138558 288266 203558 43.4% (44.0%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 118.05 117.79 0.00 0.00 0.00 0.9646 0.0000 23977452.79 23977452.79 0.00% 284368.70 284368.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.58% 66.65 37 99 138558.16 90839 270262 138621.34 126813 152783 9234522 9234522 0.00%
crit 43.42% 51.14 23 83 288265.63 181679 540523 288482.28 255745 329960 14742930 14742930 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:83.49
  • if_expr:variable.starsurge_condition1
    st
    [X]:34.56
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 28085 11.3% 38.9 7.58s 215880 0 Direct 38.7 145712 301342 216902 45.7%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.93 38.74 0.00 0.00 0.00 0.0000 0.0000 8403327.12 8403327.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.26% 21.02 6 41 145711.63 94987 282600 145777.79 121111 181241 3063150 3063150 0.00%
crit 45.74% 17.72 3 36 301341.96 189973 565201 301580.71 237353 374163 5340177 5340177 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 13454 5.4% 17.4 18.05s 231792 244329 Direct 17.4 9514 19307 13395 39.6%
Periodic 319.1 8491 17238 11898 39.0% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.39 17.39 319.14 319.14 16.39 0.9487 0.9378 4030202.60 4030202.60 0.00% 12762.04 244328.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.36% 10.50 3 19 9513.59 5655 16514 9505.54 7638 11651 99851 99851 0.00%
crit 39.64% 6.89 0 16 19306.59 11310 33028 19317.52 0 28966 133058 133058 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 61.04% 194.82 128 263 8491.08 3041 14812 8490.54 8037 9074 1654230 1654230 0.00%
crit 38.96% 124.32 74 181 17238.01 3064 29950 17239.22 16109 18382 2143064 2143064 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.44
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.94
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (4359) 0.0% (1.8%) 8.7 31.71s 149738 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 2271 0.9% 8.7 31.71s 78019 0 Direct 8.7 60496 120887 78022 29.0%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.73 8.73 0.00 0.00 0.00 0.0000 0.0000 680819.07 680819.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.99% 6.19 0 19 60496.43 58599 68863 60464.83 0 68863 374743 374743 0.00%
crit 29.01% 2.53 0 11 120887.31 117198 137726 112486.32 0 137726 306076 306076 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51134.41
  • base_dd_max:51134.41
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 2087 0.8% 16.9 15.41s 37083 0 Direct 16.9 28773 57487 37082 28.9%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.88 16.88 0.00 0.00 0.00 0.0000 0.0000 625844.13 625844.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.06% 11.99 1 30 28772.67 27883 32767 28772.48 27883 32411 345059 345059 0.00%
crit 28.94% 4.88 0 17 57486.79 55766 65534 56890.44 0 65534 280785 280785 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24330.91
  • base_dd_max:24330.91
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 24052 9.7% 120.2 2.44s 59881 64540 Direct 119.8 39807 82241 60112 47.9%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.23 119.77 0.00 0.00 0.00 0.9278 0.0000 7199726.14 7199726.14 0.00% 64540.28 64540.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.15% 62.46 36 96 39807.21 15347 124977 39815.54 34990 45996 2486347 2486347 0.00%
crit 47.85% 57.31 30 91 82240.55 30693 251256 82274.55 72023 94936 4713379 4713379 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:118.55

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
howling_rune_3
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:howling_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:howling_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:howling_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 195.72s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 65.47s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.68 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:howling_rune_3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:35466.09
  • base_dd_max:35466.09
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.32s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:howling_rune_3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 306.75s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.0 49.64s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.02 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.02
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 9.2 1.1 34.0s 33.2s 8.3s 25.52% 29.42% 1.1 (6.4) 9.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 48.9s
  • trigger_min/max:2.6s / 48.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.23% / 28.05%

Stack Uptimes

  • balance_of_all_things_arcane_1:3.02%
  • balance_of_all_things_arcane_2:3.03%
  • balance_of_all_things_arcane_3:3.05%
  • balance_of_all_things_arcane_4:3.07%
  • balance_of_all_things_arcane_5:3.10%
  • balance_of_all_things_arcane_6:3.32%
  • balance_of_all_things_arcane_7:3.46%
  • balance_of_all_things_arcane_8:3.46%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.8 2.5 16.3s 14.3s 8.2s 51.15% 55.15% 2.5 (15.2) 18.2

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.4s
  • trigger_min/max:0.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.5s
  • uptime_min/max:45.98% / 54.76%

Stack Uptimes

  • balance_of_all_things_nature_1:6.09%
  • balance_of_all_things_nature_2:6.14%
  • balance_of_all_things_nature_3:6.21%
  • balance_of_all_things_nature_4:6.29%
  • balance_of_all_things_nature_5:6.39%
  • balance_of_all_things_nature_6:6.51%
  • balance_of_all_things_nature_7:6.66%
  • balance_of_all_things_nature_8:6.86%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.3 63.5 43.3s 4.1s 20.0s 48.99% 0.00% 35.2 (35.2) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.6s
  • trigger_min/max:0.8s / 41.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.62% / 55.00%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.59%
  • balance_t31_4pc_buff_lunar_2:4.46%
  • balance_t31_4pc_buff_lunar_3:4.86%
  • balance_t31_4pc_buff_lunar_4:5.72%
  • balance_t31_4pc_buff_lunar_5:29.36%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 13.9 104.2 22.3s 2.5s 19.6s 90.76% 0.00% 50.4 (50.4) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.1s
  • trigger_min/max:0.8s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:87.57% / 93.33%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.28%
  • balance_t31_4pc_buff_solar_2:10.95%
  • balance_t31_4pc_buff_solar_3:15.80%
  • balance_t31_4pc_buff_solar_4:11.52%
  • balance_t31_4pc_buff_solar_5:45.21%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.7s 70.7s 10.8s 9.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 351.3s
  • trigger_min/max:12.0s / 351.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 40.59%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.89%
  • best_friends_with_aerwynn_2:0.89%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.90%
  • best_friends_with_aerwynn_5:0.90%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.91%
  • best_friends_with_aerwynn_8:0.91%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.92%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 114.5s 70.7s 45.6s 33.20% 0.00% 69.3 (69.3) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 353.1s
  • trigger_min/max:12.0s / 351.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 327.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.20%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.3s 70.3s 10.8s 9.97% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 349.5s
  • trigger_min/max:12.0s / 349.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 33.50%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.89%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.90%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.91%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.92%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.1s 70.3s 45.9s 33.37% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:286.52

Trigger Details

  • interval_min/max:13.0s / 353.5s
  • trigger_min/max:12.0s / 349.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 347.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.37%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 69.9s 69.9s 10.8s 10.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.0s / 331.0s
  • trigger_min/max:12.0s / 331.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 37.01%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.1s 69.9s 45.8s 33.44% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:286.52

Trigger Details

  • interval_min/max:12.5s / 349.0s
  • trigger_min/max:12.0s / 331.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 307.8s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.44%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.0s 58.2s 50.3s 80.25% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 352.0s
  • trigger_min/max:15.0s / 311.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.6s
  • uptime_min/max:44.24% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.25%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.8 0.0 44.7s 31.1s 41.8s 58.47% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 263.3s
  • trigger_min/max:0.0s / 148.2s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 260.3s
  • uptime_min/max:21.01% / 96.82%

Stack Uptimes

  • denizen_of_the_dream_1:38.79%
  • denizen_of_the_dream_2:15.04%
  • denizen_of_the_dream_3:3.83%
  • denizen_of_the_dream_4:0.71%
  • denizen_of_the_dream_5:0.11%
  • denizen_of_the_dream_6:0.02%
  • denizen_of_the_dream_7:0.01%
  • denizen_of_the_dream_8:0.01%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.0 0.9 20.7s 20.6s 2.9s 14.44% 19.97% 0.9 (1.8) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 56.0s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.9s
  • uptime_min/max:8.66% / 25.07%

Stack Uptimes

  • dreamstate_1:9.07%
  • dreamstate_2:5.38%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.3 1.0 43.7s 43.3s 20.4s 49.95% 52.95% 1.0 (1.0) 7.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.6s
  • trigger_min/max:12.0s / 89.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.58% / 56.10%

Stack Uptimes

  • eclipse_lunar_1:49.95%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.4 22.4s 15.9s 20.2s 93.22% 96.30% 5.4 (5.4) 12.9

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 69.9s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.4s
  • uptime_min/max:90.90% / 95.25%

Stack Uptimes

  • eclipse_solar_1:93.22%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.0s 307.0s 27.4s 13.21% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.3s
  • trigger_min/max:300.0s / 328.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.89% / 18.03%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.21%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.3 3.5 54.9s 31.1s 25.2s 44.50% 44.42% 3.5 (3.5) 4.9

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 234.7s
  • trigger_min/max:0.0s / 148.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 168.4s
  • uptime_min/max:14.01% / 84.56%

Stack Uptimes

  • friend_of_the_fae_1:44.50%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.3 0.0 43.3s 43.3s 20.0s 49.06% 51.66% 0.0 (0.0) 7.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.6s
  • trigger_min/max:12.0s / 89.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.84% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:49.06%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 98.5s 98.5s 19.5s 23.40% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:65.76

Trigger Details

  • interval_min/max:90.0s / 120.5s
  • trigger_min/max:90.0s / 120.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.40% / 26.39%

Stack Uptimes

  • kindled_soul_5:1.12%
  • kindled_soul_10:1.15%
  • kindled_soul_15:1.15%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.16%
  • kindled_soul_30:1.16%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.17%
  • kindled_soul_50:1.17%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.18%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.19%
  • kindled_soul_85:1.19%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.20%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.6s 20.6s 5.9s 25.40% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.1s
  • trigger_min/max:12.8s / 70.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:20.75% / 30.10%

Stack Uptimes

  • natures_grace_1:25.40%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.8s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.8s
  • trigger_min/max:90.0s / 91.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.56% / 21.05%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.1 73.7s 67.6s 7.8s 6.52% 7.19% 0.1 (0.1) 1.4

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.4s / 338.9s
  • trigger_min/max:0.1s / 338.9s
  • trigger_pct:14.96%
  • duration_min/max:0.0s / 41.3s
  • uptime_min/max:0.00% / 25.57%

Stack Uptimes

  • owlkin_frenzy_1:6.52%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.3 110.7 37.9s 37.9s 34.0s 94.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.2s / 49.3s
  • trigger_min/max:24.2s / 49.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.5s
  • uptime_min/max:90.78% / 96.82%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.14%
  • primordial_arcanic_pulsar_8:5.03%
  • primordial_arcanic_pulsar_12:6.76%
  • primordial_arcanic_pulsar_16:6.95%
  • primordial_arcanic_pulsar_20:6.47%
  • primordial_arcanic_pulsar_24:5.96%
  • primordial_arcanic_pulsar_28:6.58%
  • primordial_arcanic_pulsar_32:8.20%
  • primordial_arcanic_pulsar_36:6.75%
  • primordial_arcanic_pulsar_40:7.26%
  • primordial_arcanic_pulsar_44:7.39%
  • primordial_arcanic_pulsar_48:6.70%
  • primordial_arcanic_pulsar_52:7.86%
  • primordial_arcanic_pulsar_56:7.12%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 19.0 3.3 16.3s 14.3s 6.3s 39.81% 40.06% 3.3 (3.3) 18.5

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.4s
  • trigger_min/max:0.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.7s
  • uptime_min/max:36.01% / 43.12%

Stack Uptimes

  • solstice_1:39.81%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 97.2 14.6s 2.5s 14.0s 97.46% 0.00% 56.0 (56.0) 7.5

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.2s
  • trigger_min/max:0.8s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.79% / 99.18%

Stack Uptimes

  • starlord_1:9.04%
  • starlord_2:14.44%
  • starlord_3:73.98%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.3 47.9s 5.5s 43.2s 90.18% 0.00% 54.4 (54.4) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:482.27

Trigger Details

  • interval_min/max:10.0s / 340.0s
  • trigger_min/max:5.0s / 35.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 350.0s
  • uptime_min/max:74.03% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.18%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 60.9s 45.5s 16.5s 23.73% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 233.4s
  • trigger_min/max:0.0s / 233.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 65.2s
  • uptime_min/max:4.55% / 59.94%

Stack Uptimes

  • wafting_devotion_1:23.73%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.0 0.0 49.8s 49.8s 21.8s 43.74% 42.82% 0.0 (0.0) 2.6

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 81.7s
  • trigger_min/max:45.0s / 81.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.10% / 51.04%

Stack Uptimes

  • warrior_of_elune_1:21.06%
  • warrior_of_elune_2:5.04%
  • warrior_of_elune_3:17.65%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.8 2.0 24.0 31.1s 0.0s 148.2s
Primordial Arcanic Pulsar 7.4 6.0 9.0 39.6s 28.9s 48.9s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.31% 0.4s 0.0s 3.3s
Astral Smolder 80.05% 60.38% 92.59% 16.0s 0.0s 136.7s
Incarnation (Total) 49.06% 43.84% 55.00% 20.0s 0.0s 54.0s
Incarnation (Pulsar) 28.80% 26.62% 31.21% 11.7s 0.0s 12.0s
Lunar Eclipse Only 0.89% 0.70% 1.10% 2.6s 2.5s 2.6s
Solar Eclipse Only 44.16% 36.37% 49.94% 11.2s 0.0s 15.0s
No Eclipse 5.87% 3.62% 8.15% 1.4s 0.0s 3.2s
Friend of the Fae 44.50% 14.01% 84.56% 25.2s 0.0s 168.4s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune8.2930.00036.73450.00426.06872.366
Full Moon
New Moon
Half Moon
0.3380.00024.2465.7595.24729.781

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.264.4%59.6750.5%0.000.0%53.3045.1%
Starfire24.7092.5%0.000.0%2.007.5%0.000.0%
Starsurge0.000.0%47.2540.0%0.000.0%70.8060.0%
New Moon0.010.2%0.244.0%0.000.0%5.7695.8%
Half Moon0.000.0%0.274.7%0.000.0%5.4395.3%
Full Moon0.211.7%3.0826.0%0.080.6%8.4771.6%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
howling_rune_3
Nature's BalanceAstral Power99.43198.765.34%2.000.100.05%
Full MoonAstral Power5.32265.497.14%49.920.420.16%
Half MoonAstral Power5.70136.733.68%24.000.000.00%
MoonfireAstral Power14.3586.042.31%6.000.070.08%
New MoonAstral Power6.0272.201.94%12.000.000.00%
Orbit BreakerAstral Power6.51194.225.22%29.831.090.56%
Shooting Stars (Moonfire)Astral Power97.53194.875.24%2.000.180.09%
Shooting Stars (Sunfire)Astral Power97.93195.675.26%2.000.190.10%
StarfireAstral Power26.70390.7110.51%14.632.800.71%
SunfireAstral Power17.39104.312.80%6.000.010.01%
WrathAstral Power120.231880.2250.55%15.640.000.00%
Usage Type Count Total Tot% Avg RPE APR
howling_rune_3
StarsurgeAstral Power 118.233731.61100.00%31.5631.618677.44
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 896040.0 4077.27 4953.01 1654986.8 633494.4 -620009.6 896040.0
Astral Power 70.0 12.41 12.43 4.9 23.5 0.0 100.0
Created with Highcharts 4.2.3howling_rune_3 Astral Power Gainswrath: 1880.2starfire: 390.7full_moon: 265.5Natures Balance: 198.8shooting_stars_sunfire: 195.7shooting_stars_moonfire: 194.9orbit_breaker: 194.2half_moon: 136.7sunfire: 104.3moonfire: 86.0new_moon: 72.2
Created with Highcharts 4.2.3Time (seconds)Average Astral Powerhowling_rune_3 Astral Power0100200300050100

Statistics & Data Analysis

Fight Length
howling_rune_3 Fight Length
Count 20350
Mean 299.80
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.6641
5th Percentile 246.10
95th Percentile 353.90
( 95th Percentile - 5th Percentile ) 107.80
Mean Distribution
Standard Deviation 0.2430
95.00% Confidence Interval ( 299.32 - 300.28 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 514
0.1% Error 51357
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1026
DPS
howling_rune_3 Damage Per Second
Count 20350
Mean 248999.00
Minimum 215013.26
Maximum 286375.77
Spread ( max - min ) 71362.51
Range [ ( max - min ) / 2 * 100% ] 14.33%
Standard Deviation 9042.4400
5th Percentile 234826.68
95th Percentile 264369.94
( 95th Percentile - 5th Percentile ) 29543.26
Mean Distribution
Standard Deviation 63.3875
95.00% Confidence Interval ( 248874.76 - 249123.24 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5067
0.1 Scale Factor Error with Delta=300 698000
0.05 Scale Factor Error with Delta=300 2791997
0.01 Scale Factor Error with Delta=300 69799923
Priority Target DPS
howling_rune_3 Priority Target Damage Per Second
Count 20350
Mean 248999.00
Minimum 215013.26
Maximum 286375.77
Spread ( max - min ) 71362.51
Range [ ( max - min ) / 2 * 100% ] 14.33%
Standard Deviation 9042.4400
5th Percentile 234826.68
95th Percentile 264369.94
( 95th Percentile - 5th Percentile ) 29543.26
Mean Distribution
Standard Deviation 63.3875
95.00% Confidence Interval ( 248874.76 - 249123.24 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5067
0.1 Scale Factor Error with Delta=300 698000
0.05 Scale Factor Error with Delta=300 2791997
0.01 Scale Factor Error with Delta=300 69799923
DPS(e)
howling_rune_3 Damage Per Second (Effective)
Count 20350
Mean 248999.00
Minimum 215013.26
Maximum 286375.77
Spread ( max - min ) 71362.51
Range [ ( max - min ) / 2 * 100% ] 14.33%
Damage
howling_rune_3 Damage
Count 20350
Mean 72116787.16
Minimum 53304365.59
Maximum 92199212.94
Spread ( max - min ) 38894847.35
Range [ ( max - min ) / 2 * 100% ] 26.97%
DTPS
howling_rune_3 Damage Taken Per Second
Count 20350
Mean 4952.34
Minimum 1352.29
Maximum 9878.46
Spread ( max - min ) 8526.17
Range [ ( max - min ) / 2 * 100% ] 86.08%
HPS
howling_rune_3 Healing Per Second
Count 20350
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
howling_rune_3 Healing Per Second (Effective)
Count 20350
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
howling_rune_3 Heal
Count 20350
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
howling_rune_3 Healing Taken Per Second
Count 20350
Mean 4064.91
Minimum 920.97
Maximum 8375.63
Spread ( max - min ) 7454.66
Range [ ( max - min ) / 2 * 100% ] 91.70%
TMI
howling_rune_3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
howling_rune_3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
howling_rune_3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.60 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.44 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.30 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.02 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 24.75 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 83.49 starsurge,if=variable.starsurge_condition1
R 15.94 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.05 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.03 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.72 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.37 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.34 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 34.56 starsurge,if=variable.starsurge_condition2
Y 118.55 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVYXYYRXYXYSWQQYQYYYYXYXOTYXYYXXRWQQQYYQYYYSYXYXXYPPYQQRYQYYYYXXYPPSQQUQRYQQVOYXXYXPPQYQYSQRYYYYFXYWQPPQYQYYQYYRSYWQEQTQUQYYYYXOXYPPWQQRQYYSYXYYXYWQPPQYQRYQYYYYYWQQQSVQQTRYYPPWQQYQYQYYYOXSYXRWQPPQYFQYYQYYYYXUQQRQSVEXYPNQYYXYTQQQYYRYYXSXXYYXYYQQQYQUQRYYYYXYYOWQQQSYYXPPQYQRYYYQQYYQYSPPQYYYRWQQVFQQTYYYXPPWQQS

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask howling_rune_3 50.0/100: 50% astral_power
Pre precombat 1 food howling_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation howling_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent howling_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket howling_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket howling_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket howling_rune_3 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil howling_rune_3 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.911 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.822 st L starfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.642 st N incarnation_chosen_of_elune Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.642 default D potion Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage
0:02.642 default E use_items Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:02.642 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.470 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.267 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.036 st T new_moon Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.789 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.542 st U half_moon Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.528 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.282 st V full_moon Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.759 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.513 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:11.267 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.021 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.775 st R sunfire Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.530 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:14.285 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.040 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.795 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.549 st S moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:17.303 st W cancel_buff Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.303 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.133 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:18.931 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.700 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.469 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:21.225 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.980 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.736 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:23.489 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:24.244 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:24.999 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:25.755 st O warrior_of_elune Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:25.755 st T new_moon Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.508 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.262 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.015 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.770 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.526 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.280 st X starsurge Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.035 st R sunfire Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.789 st W cancel_buff Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.789 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.618 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:33.416 st Q starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:34.186 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:34.941 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:35.695 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:36.448 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:37.202 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:37.957 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:38.713 st S moonfire Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:39.467 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:40.221 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
0:41.183 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
0:42.143 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
0:43.104 st X starsurge Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
0:44.066 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, corrupting_rage
0:45.028 st P starfire Fluffy_Pillow 36.0/100: 36% astral_power natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:45.783 st P starfire Fluffy_Pillow 52.8/100: 53% astral_power natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:46.536 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:47.497 st Q starsurge Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:48.574 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:49.610 st R sunfire Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:50.609 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:51.606 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:52.702 st Y wrath Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:53.758 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:54.815 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:55.872 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:56.930 st X starsurge Fluffy_Pillow 83.6/100: 84% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:57.986 st X starsurge Fluffy_Pillow 53.6/100: 54% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:58.969 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:59.950 st P starfire Fluffy_Pillow 37.6/100: 38% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:01.421 st P starfire Fluffy_Pillow 51.6/100: 52% astral_power natures_grace, primordial_arcanic_pulsar(52), starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:02.226 st S moonfire Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:03.121 st Q starsurge Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:04.122 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:05.084 st U half_moon Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:06.208 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:07.050 st R sunfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:07.944 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:08.699 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:09.594 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:10.488 st V full_moon Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:12.271 st O warrior_of_elune Fluffy_Pillow 71.6/100: 72% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:12.271 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:13.165 st X starsurge Fluffy_Pillow 87.6/100: 88% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:14.127 st X starsurge Fluffy_Pillow 59.6/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:15.090 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:16.051 st X starsurge Fluffy_Pillow 49.6/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:17.011 st P starfire Fluffy_Pillow 21.6/100: 22% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak
1:17.765 st P starfire Fluffy_Pillow 38.4/100: 38% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, undulating_sporecloak
1:18.517 st Q starsurge Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak
1:19.595 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
1:20.630 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
1:21.666 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
1:22.665 st S moonfire Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
1:23.762 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
1:24.859 st R sunfire Fluffy_Pillow 5.2/100: 5% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:25.916 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:26.974 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:28.032 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:29.090 st Y wrath Fluffy_Pillow 63.2/100: 63% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:30.148 default F natures_vigil howling_rune_3 81.2/100: 81% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:30.148 st X starsurge Fluffy_Pillow 81.2/100: 81% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
1:31.206 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak
1:32.264 st W cancel_buff Fluffy_Pillow 67.2/100: 67% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:32.264 st Q starsurge Fluffy_Pillow 67.2/100: 67% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(40), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:33.448 st P starfire Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(44), starlord, warrior_of_elune, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:34.202 st P starfire Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(44), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:35.132 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:36.168 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:37.165 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:38.162 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:39.125 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:40.181 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:41.237 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:42.294 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:43.351 st R sunfire Fluffy_Pillow 54.0/100: 54% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:44.409 st S moonfire Fluffy_Pillow 60.0/100: 60% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:45.466 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:46.524 st W cancel_buff Fluffy_Pillow 84.0/100: 84% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:46.524 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:47.709 default E use_items Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:47.709 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
1:48.743 st T new_moon Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
1:49.497 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
1:50.493 st U half_moon Fluffy_Pillow 12.0/100: 12% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
1:51.773 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
1:52.733 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
1:53.695 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
1:54.656 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
1:55.617 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(65)
1:56.579 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(60)
1:57.541 st O warrior_of_elune Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(55)
1:57.541 st X starsurge Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(55)
1:58.502 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(50)
1:59.463 st P starfire Fluffy_Pillow 40.0/100: 40% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(45)
2:00.218 st P starfire Fluffy_Pillow 58.8/100: 59% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
2:00.971 st W cancel_buff Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
2:00.971 st Q starsurge Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
2:02.047 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
2:03.083 st R sunfire Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
2:04.080 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
2:05.078 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
2:06.137 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
2:07.193 st S moonfire Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
2:08.250 st Y wrath Fluffy_Pillow 57.6/100: 58% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:09.307 st X starsurge Fluffy_Pillow 75.6/100: 76% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:10.364 st Y wrath Fluffy_Pillow 41.6/100: 42% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:11.422 st Y wrath Fluffy_Pillow 57.6/100: 58% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak
2:12.481 st X starsurge Fluffy_Pillow 75.6/100: 76% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak
2:13.538 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak
2:14.597 st W cancel_buff Fluffy_Pillow 55.6/100: 56% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak
2:14.597 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak
2:15.780 st P starfire Fluffy_Pillow 21.6/100: 22% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord, warrior_of_elune(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
2:16.534 st P starfire Fluffy_Pillow 38.4/100: 38% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak
2:17.288 st Q starsurge Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_aerwynn_static, undulating_sporecloak
2:18.324 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak
2:19.321 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak
2:20.318 st R sunfire Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
2:21.279 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
2:22.336 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
2:23.393 st Y wrath Fluffy_Pillow 3.2/100: 3% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:24.453 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:25.508 st Y wrath Fluffy_Pillow 37.2/100: 37% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:26.566 st Y wrath Fluffy_Pillow 53.2/100: 53% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:27.623 st Y wrath Fluffy_Pillow 73.2/100: 73% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:28.682 st W cancel_buff Fluffy_Pillow 89.2/100: 89% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:28.682 st Q starsurge Fluffy_Pillow 89.2/100: 89% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:29.866 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:30.900 st Q starsurge Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:31.897 st S moonfire Fluffy_Pillow 1.2/100: 1% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:32.858 st V full_moon Fluffy_Pillow 9.2/100: 9% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:34.645 st Q starsurge Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:35.538 st Q starsurge Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:36.432 st T new_moon Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:37.187 st R sunfire Fluffy_Pillow 23.2/100: 23% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:38.079 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:38.973 st Y wrath Fluffy_Pillow 49.2/100: 49% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:39.866 st P starfire Fluffy_Pillow 67.2/100: 67% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:41.205 st P starfire Fluffy_Pillow 83.2/100: 83% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:42.010 st W cancel_buff Fluffy_Pillow 97.2/100: 97% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:42.010 st Q starsurge Fluffy_Pillow 97.2/100: 97% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:43.011 st Q starsurge Fluffy_Pillow 65.2/100: 65% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:43.973 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:44.727 st Q starsurge Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:45.654 st Y wrath Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:46.548 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:47.442 st Y wrath Fluffy_Pillow 5.2/100: 5% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), solstice, starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage
2:48.425 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, corrupting_rage
2:49.483 st Y wrath Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, corrupting_rage
2:50.541 st O warrior_of_elune Fluffy_Pillow 89.2/100: 89% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:50.541 st X starsurge Fluffy_Pillow 89.2/100: 89% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:51.599 st S moonfire Fluffy_Pillow 55.2/100: 55% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:52.657 st Y wrath Fluffy_Pillow 63.2/100: 63% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:53.717 st X starsurge Fluffy_Pillow 81.2/100: 81% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:54.775 st R sunfire Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:55.833 st W cancel_buff Fluffy_Pillow 53.2/100: 53% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:55.833 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:57.018 st P starfire Fluffy_Pillow 19.2/100: 19% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord, warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:57.773 st P starfire Fluffy_Pillow 36.0/100: 36% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord, warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:58.527 st Q starsurge Fluffy_Pillow 52.8/100: 53% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:59.564 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:00.561 default F natures_vigil howling_rune_3 40.8/100: 41% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:00.561 st Q starsurge Fluffy_Pillow 40.8/100: 41% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:01.559 st Y wrath Fluffy_Pillow 6.8/100: 7% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:02.520 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:03.482 st Q starsurge Fluffy_Pillow 40.8/100: 41% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:04.539 st Y wrath Fluffy_Pillow 6.8/100: 7% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:05.597 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:06.655 st Y wrath Fluffy_Pillow 44.8/100: 45% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:07.713 st Y wrath Fluffy_Pillow 60.8/100: 61% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:08.770 st X starsurge Fluffy_Pillow 76.8/100: 77% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:09.829 st U half_moon Fluffy_Pillow 48.8/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:11.109 st Q starsurge Fluffy_Pillow 74.8/100: 75% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:12.186 st Q starsurge Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:13.221 st R sunfire Fluffy_Pillow 24.8/100: 25% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:14.218 st Q starsurge Fluffy_Pillow 32.8/100: 33% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:15.217 st S moonfire Fluffy_Pillow 6.8/100: 7% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:16.180 st V full_moon Fluffy_Pillow 12.8/100: 13% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:18.100 default E use_items Fluffy_Pillow 66.8/100: 67% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:18.100 st X starsurge Fluffy_Pillow 66.8/100: 67% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
3:19.060 st Y wrath Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
3:20.023 st P starfire Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
3:21.464 st N incarnation_chosen_of_elune Fluffy_Pillow 70.8/100: 71% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), dreamstate(2), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
3:21.464 st Q starsurge Fluffy_Pillow 70.8/100: 71% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
3:22.338 st Y wrath Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
3:23.092 st Y wrath Fluffy_Pillow 58.8/100: 59% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
3:23.846 st X starsurge Fluffy_Pillow 78.8/100: 79% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
3:24.723 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
3:25.596 st T new_moon Fluffy_Pillow 72.8/100: 73% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
3:26.351 st Q starsurge Fluffy_Pillow 86.8/100: 87% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
3:27.330 st Q starsurge Fluffy_Pillow 64.8/100: 65% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
3:28.366 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
3:29.364 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
3:30.327 st Y wrath Fluffy_Pillow 28.8/100: 29% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(40)
3:31.220 st R sunfire Fluffy_Pillow 44.8/100: 45% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(35)
3:32.113 st Y wrath Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(30)
3:33.008 st Y wrath Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(30)
3:33.904 st X starsurge Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(25)
3:34.797 st S moonfire Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(20)
3:35.688 st X starsurge Fluffy_Pillow 66.8/100: 67% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(15)
3:36.580 st X starsurge Fluffy_Pillow 40.8/100: 41% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(10)
3:37.473 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(5)
3:38.368 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:39.260 st X starsurge Fluffy_Pillow 48.8/100: 49% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:40.153 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:41.045 st Y wrath Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:41.941 st Q starsurge Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:42.941 st Q starsurge Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:43.903 st Q starsurge Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:44.829 st Y wrath Fluffy_Pillow 6.8/100: 7% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:45.789 st Q starsurge Fluffy_Pillow 28.8/100: 29% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:46.751 st U half_moon Fluffy_Pillow 2.8/100: 3% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:48.034 st Q starsurge Fluffy_Pillow 30.8/100: 31% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:48.995 st R sunfire Fluffy_Pillow 4.8/100: 5% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:49.959 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:50.920 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:51.881 st Y wrath Fluffy_Pillow 44.8/100: 45% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:52.844 st Y wrath Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:53.805 st X starsurge Fluffy_Pillow 78.8/100: 79% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:54.766 st Y wrath Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:55.727 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:56.690 st O warrior_of_elune Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:56.690 st W cancel_buff Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:56.690 st Q starsurge Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:57.766 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:58.802 st Q starsurge Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:59.800 st S moonfire Fluffy_Pillow 6.8/100: 7% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:00.763 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:01.725 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:02.687 st X starsurge Fluffy_Pillow 48.8/100: 49% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:03.650 st P starfire Fluffy_Pillow 22.8/100: 23% astral_power denizen_of_the_dream(4), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:04.405 st P starfire Fluffy_Pillow 39.6/100: 40% astral_power denizen_of_the_dream(4), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:05.160 st Q starsurge Fluffy_Pillow 60.4/100: 60% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:06.122 st Y wrath Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:07.085 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:08.045 st R sunfire Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:09.007 st Y wrath Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:09.969 st Y wrath Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:11.027 st Y wrath Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:12.083 st Q starsurge Fluffy_Pillow 72.4/100: 72% astral_power balance_of_all_things_nature, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:13.268 st Q starsurge Fluffy_Pillow 36.4/100: 36% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:14.407 st Y wrath Fluffy_Pillow 0.4/100: 0% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:15.502 st Y wrath Fluffy_Pillow 18.4/100: 18% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:16.599 st Q starsurge Fluffy_Pillow 36.4/100: 36% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:17.695 st Y wrath Fluffy_Pillow 0.4/100: 0% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:18.753 st S moonfire Fluffy_Pillow 18.4/100: 18% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:19.810 st P starfire Fluffy_Pillow 24.4/100: 24% astral_power denizen_of_the_dream(2), natures_grace, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:20.565 st P starfire Fluffy_Pillow 41.2/100: 41% astral_power denizen_of_the_dream(2), natures_grace, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:21.431 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:22.392 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:23.353 st Y wrath Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:24.316 st Y wrath Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:25.280 st R sunfire Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:26.242 st W cancel_buff Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:26.242 st Q starsurge Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), solstice, balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:27.426 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:28.463 st V full_moon Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:30.453 default F natures_vigil howling_rune_3 75.2/100: 75% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:30.561 st Q starsurge Fluffy_Pillow 75.2/100: 75% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:31.559 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:32.520 st T new_moon Fluffy_Pillow 21.2/100: 21% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:33.277 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:34.238 st Y wrath Fluffy_Pillow 51.2/100: 51% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:35.199 st Y wrath Fluffy_Pillow 67.2/100: 67% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:36.161 st X starsurge Fluffy_Pillow 85.2/100: 85% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:37.124 st P starfire Fluffy_Pillow 57.2/100: 57% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:38.566 st P starfire Fluffy_Pillow 73.2/100: 73% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(16), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:39.431 st W cancel_buff Fluffy_Pillow 89.2/100: 89% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:39.431 st Q starsurge Fluffy_Pillow 89.2/100: 89% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:40.506 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:41.543 st S moonfire Fluffy_Pillow 21.2/100: 21% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), balance_t31_4pc_buff_solar(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 44802 42669 38981
Intellect 2089 0 15839 14916 12117 (7543)
Spirit 0 0 0 0 0
Health 896040 853380 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 15839 14916 0
Crit 28.72% 22.51% 3151
Haste 27.11% 27.11% 4395
Versatility 9.14% 4.14% 849
Mana Regen 2560 2560 0
Attack Power 16473 15513 0
Mastery 28.50% 28.50% 7312
Armor 5330 5330 5330
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 489.00
Local Head Benevolent Embersage's Casque
ilevel: 489, stats: { 673 Armor, +3966 Sta, +704 Crit, +330 Haste, +938 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 489, stats: { +2231 Sta, +256 Haste, +1537 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 489, stats: { 617 Armor, +2975 Sta, +230 Haste, +545 Vers, +704 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 489, stats: { 897 Armor, +3966 Sta, +715 Crit, +318 Mastery, +938 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 489, stats: { 505 Armor, +2975 Sta, +535 Haste, +241 Mastery, +704 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 489, stats: { 785 Armor, +3966 Sta, +705 Haste, +328 Mastery, +938 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 486, stats: { 548 Armor, +2875 Sta, +274 Crit, +438 Haste, +684 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 489, stats: { 449 Armor, +2231 Sta, +228 Crit, +353 Mastery, +528 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 489, stats: { 505 Armor, +2975 Sta, +354 Haste, +421 Mastery, +704 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 489, stats: { +2231 Sta, +512 Haste, +1281 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 489, stats: { +2231 Sta, +1230 Crit, +564 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 489, stats: { +892 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 489, stats: { +738 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 486, stats: { 351 Armor, +2156 Sta, +304 Vers, +271 Mastery, +513 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 489, weapon: { 606 - 781, 2.6 }, stats: { +469 Int, +2264 Int, +1983 Sta, +156 Haste, +361 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Howling Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 489, stats: { +1439 Int, +1983 Sta, +174 Haste, +343 Mastery }

Profile

druid="howling_rune_3"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=489,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=489,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=489
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=486
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=489,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=489,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=489
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=489,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=486
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=489,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=489
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=489
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=489,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=489

# Gear Summary
# gear_ilvl=488.63
# gear_stamina=38981
# gear_intellect=12117
# gear_crit_rating=3151
# gear_haste_rating=4395
# gear_mastery_rating=7312
# gear_versatility_rating=849
# gear_armor=5330
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

Simulation & Raid Information

Iterations: 20382
Threads: 32
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.9 )

Performance:

Total Events Processed: 529100310
Max Event Queue: 79
Sim Seconds: 6111580
CPU Seconds: 456.9926
Physical Seconds: 19.0552
Speed Up: 13373

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Base Base astral_smolder ticks -394061 5354633 17849 23.77 45055 0 67.5 118.8 0.0% 0.0% 0.0% 0.0% 4.39sec 5354633 299.94sec
Base Base augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Base Base denizen_of_the_dream 394065 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 31.67sec 0 299.94sec
Base Base fey_missile 188046 2364668 7884 30.58 12010 23986 153.8 152.9 28.9% 0.0% 0.0% 0.0% 1.70sec 2364668 299.94sec
Base Base flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Base Base food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Base Base hungering_shadowflame 424324 1222103 4074 3.49 54116 108769 17.5 17.5 29.0% 0.0% 0.0% 0.0% 16.53sec 1222103 299.94sec
Base Base hungering_shadowflame_self 424324 698692 2329 3.49 31031 62040 17.5 17.5 29.0% 0.0% 0.0% 0.0% 16.53sec 793761 299.94sec
Base Base incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 192.29sec 0 299.94sec
Base Base launched_thorns 379403 1116993 3724 6.89 25151 50261 34.5 34.4 29.0% 0.0% 0.0% 0.0% 8.48sec 1116993 299.94sec
Base Base launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 66.81sec 0 299.94sec
Base Base moonfire 8921 188334 628 2.87 9509 19513 14.3 14.3 36.2% 0.0% 0.0% 0.0% 21.60sec 3957488 299.94sec
Base Base moonfire ticks -8921 3769154 12564 62.72 8597 17949 14.3 313.6 36.6% 0.0% 0.0% 0.0% 21.60sec 3957488 299.94sec
Base Base moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Base Base moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.92sec 0 299.94sec
Base Base full_moon 274283 2550220 8502 1.06 331868 649697 5.3 5.3 47.5% 0.0% 0.0% 0.0% 62.53sec 2550220 299.94sec
Base Base new_moon 274281 1879870 6267 1.20 202774 425245 6.0 6.0 50.2% 0.0% 0.0% 0.0% 53.40sec 1879870 299.94sec
Base Base half_moon 274282 2517142 8392 1.13 287675 571482 5.7 5.7 55.3% 0.0% 0.0% 0.0% 57.81sec 2517142 299.94sec
Base Base natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.35sec 0 299.94sec
Base Base overwhelming_rage ticks -374037 778323 2594 3.94 39466 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.58sec 883549 299.94sec
Base Base potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.33sec 0 299.94sec
Base Base shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Base Base shooting_stars_moonfire 202497 2420669 8070 19.15 16881 35437 96.0 95.7 45.3% 0.0% 0.0% 0.0% 3.13sec 2420669 299.94sec
Base Base shooting_stars_sunfire 202497 2425559 8087 19.20 16861 35383 96.3 96.0 45.4% 0.0% 0.0% 0.0% 3.10sec 2425559 299.94sec
Base Base orbit_breaker 274283 1642987 5478 1.28 170729 358926 6.4 6.4 46.0% 0.0% 0.0% 0.0% 47.53sec 1642987 299.94sec
Base Base starfire 194153 1799091 5998 5.40 47031 93920 26.0 27.0 41.9% 0.0% 0.0% 0.0% 11.50sec 1799091 299.94sec
Base Base starsurge 78674 23672863 78925 23.31 138619 287246 116.8 116.5 43.4% 0.0% 0.0% 0.0% 2.55sec 23672863 299.94sec
Base Base goldrinns_fang 394047 8292202 27646 7.67 145843 300374 38.5 38.3 45.6% 0.0% 0.0% 0.0% 7.60sec 8292202 299.94sec
Base Base sunfire 93402 232532 775 3.48 9512 19253 17.4 17.4 39.6% 0.0% 0.0% 0.0% 18.05sec 3967696 299.94sec
Base Base sunfire ticks -93402 3735164 12451 62.91 8481 17197 17.4 314.6 38.9% 0.0% 0.0% 0.0% 18.05sec 3967696 299.94sec
Base Base tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 32.00sec 0 299.94sec
Base Base denizen_of_the_flame 426486 673471 2245 1.73 60495 120904 8.6 8.6 28.9% 0.0% 0.0% 0.0% 32.00sec 673471 299.94sec
Base Base denizen_of_the_flame_secondary 426431 619391 2065 3.34 28768 57499 16.7 16.7 28.9% 0.0% 0.0% 0.0% 15.54sec 619391 299.94sec
Base Base warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.28sec 0 299.94sec
Base Base wrath 190984 7066680 23560 23.50 39879 82288 117.9 117.5 47.8% 0.0% 0.0% 0.0% 2.49sec 7066680 299.94sec
buzzing_rune_3 buzzing_rune_3 astral_smolder ticks -394061 5547703 18492 24.12 45997 0 69.9 120.6 0.0% 0.0% 0.0% 0.0% 4.29sec 5547703 299.62sec
buzzing_rune_3 buzzing_rune_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.62sec
buzzing_rune_3 buzzing_rune_3 denizen_of_the_dream 394065 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 31.22sec 0 299.62sec
buzzing_rune_3 buzzing_rune_3 fey_missile 188046 2399032 8007 30.65 12008 23983 154.0 153.1 30.6% 0.0% 0.0% 0.0% 1.68sec 2399032 299.62sec
buzzing_rune_3 buzzing_rune_3 flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.62sec
buzzing_rune_3 buzzing_rune_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.62sec
buzzing_rune_3 buzzing_rune_3 hungering_shadowflame 424324 1237130 4129 3.50 54172 108262 17.5 17.5 30.7% 0.0% 0.0% 0.0% 16.48sec 1237130 299.62sec
buzzing_rune_3 buzzing_rune_3 hungering_shadowflame_self 424324 708864 2366 3.50 31031 62041 17.5 17.5 30.7% 0.0% 0.0% 0.0% 16.48sec 805325 299.62sec
buzzing_rune_3 buzzing_rune_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 191.81sec 0 299.62sec
buzzing_rune_3 buzzing_rune_3 launched_thorns 379403 1130212 3772 6.90 25150 50267 34.5 34.4 30.5% 0.0% 0.0% 0.0% 8.44sec 1130212 299.62sec
buzzing_rune_3 buzzing_rune_3 launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 69.22sec 0 299.62sec
buzzing_rune_3 buzzing_rune_3 moonfire 8921 190570 636 2.87 9513 19504 14.3 14.3 37.9% 0.0% 0.0% 0.0% 21.60sec 4006281 299.62sec
buzzing_rune_3 buzzing_rune_3 moonfire ticks -8921 3815711 12719 62.66 8599 17943 14.3 313.3 38.3% 0.0% 0.0% 0.0% 21.60sec 4006281 299.62sec
buzzing_rune_3 buzzing_rune_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.62sec
buzzing_rune_3 buzzing_rune_3 moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.93sec 0 299.62sec
buzzing_rune_3 buzzing_rune_3 full_moon 274283 2586087 8631 1.06 331888 651638 5.3 5.3 49.5% 0.0% 0.0% 0.0% 62.56sec 2586087 299.62sec
buzzing_rune_3 buzzing_rune_3 new_moon 274281 1896550 6330 1.20 202994 424997 6.0 6.0 51.5% 0.0% 0.0% 0.0% 53.46sec 1896550 299.62sec
buzzing_rune_3 buzzing_rune_3 half_moon 274282 2538132 8471 1.13 288078 571764 5.7 5.7 56.7% 0.0% 0.0% 0.0% 57.84sec 2538132 299.62sec
buzzing_rune_3 buzzing_rune_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.33sec 0 299.62sec
buzzing_rune_3 buzzing_rune_3 overwhelming_rage ticks -374037 778712 2596 3.95 39465 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.46sec 884009 299.62sec
buzzing_rune_3 buzzing_rune_3 potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.45sec 0 299.62sec
buzzing_rune_3 buzzing_rune_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.62sec
buzzing_rune_3 buzzing_rune_3 shooting_stars_moonfire 202497 2447893 8170 19.15 16884 35433 95.9 95.6 47.0% 0.0% 0.0% 0.0% 3.10sec 2447893 299.62sec
buzzing_rune_3 buzzing_rune_3 shooting_stars_sunfire 202497 2452682 8186 19.21 16857 35376 96.2 95.9 47.1% 0.0% 0.0% 0.0% 3.09sec 2452682 299.62sec
buzzing_rune_3 buzzing_rune_3 orbit_breaker 274283 1659250 5538 1.28 170766 359019 6.4 6.4 47.5% 0.0% 0.0% 0.0% 47.26sec 1659250 299.62sec
buzzing_rune_3 buzzing_rune_3 starfire 194153 1818054 6068 5.39 47088 93945 25.9 26.9 43.7% 0.0% 0.0% 0.0% 11.51sec 1818054 299.62sec
buzzing_rune_3 buzzing_rune_3 starsurge 78674 23939122 79898 23.31 138634 287261 116.7 116.4 45.1% 0.0% 0.0% 0.0% 2.55sec 23939122 299.62sec
buzzing_rune_3 buzzing_rune_3 goldrinns_fang 394047 8385241 27986 7.67 145869 300303 38.5 38.3 47.2% 0.0% 0.0% 0.0% 7.68sec 8385241 299.62sec
buzzing_rune_3 buzzing_rune_3 sunfire 93402 235001 784 3.48 9511 19246 17.4 17.4 41.2% 0.0% 0.0% 0.0% 18.05sec 4015168 299.62sec
buzzing_rune_3 buzzing_rune_3 sunfire ticks -93402 3780167 12601 62.85 8486 17204 17.4 314.2 40.6% 0.0% 0.0% 0.0% 18.05sec 4015168 299.62sec
buzzing_rune_3 buzzing_rune_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 32.11sec 0 299.62sec
buzzing_rune_3 buzzing_rune_3 denizen_of_the_flame 426486 682289 2277 1.73 60480 120887 8.6 8.6 30.6% 0.0% 0.0% 0.0% 32.11sec 682289 299.62sec
buzzing_rune_3 buzzing_rune_3 denizen_of_the_flame_secondary 426431 627424 2094 3.35 28766 57479 16.7 16.7 30.5% 0.0% 0.0% 0.0% 15.57sec 627424 299.62sec
buzzing_rune_3 buzzing_rune_3 warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.23sec 0 299.62sec
buzzing_rune_3 buzzing_rune_3 wrath 190984 7146857 23853 23.51 39865 82287 117.8 117.4 49.6% 0.0% 0.0% 0.0% 2.49sec 7146857 299.62sec
hissing_rune_3 hissing_rune_3 astral_smolder ticks -394061 5402042 18007 23.76 45475 0 67.4 118.8 0.0% 0.0% 0.0% 0.0% 4.38sec 5402042 300.04sec
hissing_rune_3 hissing_rune_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.04sec
hissing_rune_3 hissing_rune_3 denizen_of_the_dream 394065 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 31.95sec 0 300.04sec
hissing_rune_3 hissing_rune_3 fey_missile 188046 2395810 7985 30.57 12161 24295 153.8 152.9 28.9% 0.0% 0.0% 0.0% 1.72sec 2395810 300.04sec
hissing_rune_3 hissing_rune_3 flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.04sec
hissing_rune_3 hissing_rune_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.04sec
hissing_rune_3 hissing_rune_3 hungering_shadowflame 424324 1216967 4056 3.49 54042 108160 17.4 17.4 29.0% 0.0% 0.0% 0.0% 16.51sec 1216967 300.04sec
hissing_rune_3 hissing_rune_3 hungering_shadowflame_self 424324 698154 2327 3.49 31032 62044 17.4 17.4 28.9% 0.0% 0.0% 0.0% 16.51sec 793218 300.04sec
hissing_rune_3 hissing_rune_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 192.21sec 0 300.04sec
hissing_rune_3 hissing_rune_3 launched_thorns 379403 1117721 3725 6.89 25151 50265 34.6 34.5 28.9% 0.0% 0.0% 0.0% 8.50sec 1117721 300.04sec
hissing_rune_3 hissing_rune_3 launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 66.56sec 0 300.04sec
hissing_rune_3 hissing_rune_3 moonfire 8921 190189 634 2.87 9601 19687 14.3 14.3 36.2% 0.0% 0.0% 0.0% 21.60sec 3996234 300.04sec
hissing_rune_3 hissing_rune_3 moonfire ticks -8921 3806044 12687 62.74 8678 18119 14.3 313.7 36.6% 0.0% 0.0% 0.0% 21.60sec 3996234 300.04sec
hissing_rune_3 hissing_rune_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.04sec
hissing_rune_3 hissing_rune_3 moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.92sec 0 300.04sec
hissing_rune_3 hissing_rune_3 full_moon 274283 2597238 8656 1.05 338182 662590 5.3 5.3 47.5% 0.0% 0.0% 0.0% 62.49sec 2597238 300.04sec
hissing_rune_3 hissing_rune_3 new_moon 274281 1913670 6378 1.20 206856 432734 6.0 6.0 50.0% 0.0% 0.0% 0.0% 53.44sec 1913670 300.04sec
hissing_rune_3 hissing_rune_3 half_moon 274282 2561553 8537 1.13 292558 583218 5.7 5.7 54.9% 0.0% 0.0% 0.0% 57.80sec 2561553 300.04sec
hissing_rune_3 hissing_rune_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.33sec 0 300.04sec
hissing_rune_3 hissing_rune_3 overwhelming_rage ticks -374037 782881 2610 3.97 39468 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 57.73sec 888695 300.04sec
hissing_rune_3 hissing_rune_3 potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.29sec 0 300.04sec
hissing_rune_3 hissing_rune_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.04sec
hissing_rune_3 hissing_rune_3 shooting_stars_moonfire 202497 2469714 8231 19.16 17207 36116 96.1 95.8 45.3% 0.0% 0.0% 0.0% 3.10sec 2469714 300.04sec
hissing_rune_3 hissing_rune_3 shooting_stars_sunfire 202497 2472901 8242 19.21 17184 36075 96.3 96.1 45.3% 0.0% 0.0% 0.0% 3.07sec 2472901 300.04sec
hissing_rune_3 hissing_rune_3 orbit_breaker 274283 1675027 5583 1.28 174321 365704 6.4 6.4 45.8% 0.0% 0.0% 0.0% 47.15sec 1675027 300.04sec
hissing_rune_3 hissing_rune_3 starfire 194153 1818393 6060 5.40 47478 94816 26.0 27.0 42.0% 0.0% 0.0% 0.0% 11.47sec 1818393 300.04sec
hissing_rune_3 hissing_rune_3 starsurge 78674 24118188 80382 23.31 141235 292770 116.8 116.5 43.4% 0.0% 0.0% 0.0% 2.55sec 24118188 300.04sec
hissing_rune_3 hissing_rune_3 goldrinns_fang 394047 8432881 28105 7.65 148536 306121 38.4 38.3 45.6% 0.0% 0.0% 0.0% 7.68sec 8432881 300.04sec
hissing_rune_3 hissing_rune_3 sunfire 93402 234825 783 3.48 9601 19436 17.4 17.4 39.6% 0.0% 0.0% 0.0% 18.05sec 4006544 300.04sec
hissing_rune_3 hissing_rune_3 sunfire ticks -93402 3771719 12572 62.93 8561 17362 17.4 314.7 38.9% 0.0% 0.0% 0.0% 18.05sec 4006544 300.04sec
hissing_rune_3 hissing_rune_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 31.54sec 0 300.04sec
hissing_rune_3 hissing_rune_3 denizen_of_the_flame 426486 674039 2246 1.73 60493 120875 8.6 8.6 29.1% 0.0% 0.0% 0.0% 31.54sec 674039 300.04sec
hissing_rune_3 hissing_rune_3 denizen_of_the_flame_secondary 426431 620333 2067 3.35 28768 57491 16.7 16.7 28.9% 0.0% 0.0% 0.0% 15.29sec 620333 300.04sec
hissing_rune_3 hissing_rune_3 warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.20sec 0 300.04sec
hissing_rune_3 hissing_rune_3 wrath 190984 7131136 23767 23.50 40250 83061 117.9 117.5 47.7% 0.0% 0.0% 0.0% 2.49sec 7131136 300.04sec
howling_rune_3 howling_rune_3 astral_smolder ticks -394061 5423133 18077 23.93 45333 0 68.5 119.6 0.0% 0.0% 0.0% 0.0% 4.33sec 5423133 299.80sec
howling_rune_3 howling_rune_3 augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.80sec
howling_rune_3 howling_rune_3 denizen_of_the_dream 394065 0 0 0.00 0 0 8.8 0.0 0.0% 0.0% 0.0% 0.0% 30.98sec 0 299.80sec
howling_rune_3 howling_rune_3 fey_missile 188046 2437968 8132 31.51 12015 23999 158.4 157.5 28.9% 0.0% 0.0% 0.0% 1.65sec 2437968 299.80sec
howling_rune_3 howling_rune_3 flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.80sec
howling_rune_3 howling_rune_3 food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.80sec
howling_rune_3 howling_rune_3 hungering_shadowflame 424324 1239066 4133 3.55 54133 108782 17.7 17.7 28.9% 0.0% 0.0% 0.0% 16.27sec 1239066 299.80sec
howling_rune_3 howling_rune_3 hungering_shadowflame_self 424324 709133 2365 3.55 31031 62044 17.7 17.7 29.0% 0.0% 0.0% 0.0% 16.27sec 805656 299.80sec
howling_rune_3 howling_rune_3 incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 195.72sec 0 299.80sec
howling_rune_3 howling_rune_3 launched_thorns 379403 1131029 3773 6.98 25152 50266 35.0 34.9 28.9% 0.0% 0.0% 0.0% 8.36sec 1131029 299.80sec
howling_rune_3 howling_rune_3 launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 65.47sec 0 299.80sec
howling_rune_3 howling_rune_3 moonfire 8921 190663 636 2.87 9576 19658 14.4 14.4 36.8% 0.0% 0.0% 0.0% 21.59sec 4022178 299.80sec
howling_rune_3 howling_rune_3 moonfire ticks -8921 3831515 12772 63.63 8610 17991 14.4 318.2 36.6% 0.0% 0.0% 0.0% 21.59sec 4022178 299.80sec
howling_rune_3 howling_rune_3 moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.80sec
howling_rune_3 howling_rune_3 moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.89sec 0 299.80sec
howling_rune_3 howling_rune_3 full_moon 274283 2570073 8573 1.06 333698 653855 5.3 5.3 47.6% 0.0% 0.0% 0.0% 62.04sec 2570073 299.80sec
howling_rune_3 howling_rune_3 new_moon 274281 1872841 6247 1.20 202421 424700 6.0 6.0 49.7% 0.0% 0.0% 0.0% 53.25sec 1872841 299.80sec
howling_rune_3 howling_rune_3 half_moon 274282 2530794 8442 1.13 289798 574836 5.7 5.7 55.0% 0.0% 0.0% 0.0% 57.54sec 2530794 299.80sec
howling_rune_3 howling_rune_3 natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.32sec 0 299.80sec
howling_rune_3 howling_rune_3 overwhelming_rage ticks -374037 775780 2586 3.93 39467 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 58.92sec 880647 299.80sec
howling_rune_3 howling_rune_3 potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.75sec 0 299.80sec
howling_rune_3 howling_rune_3 shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.80sec
howling_rune_3 howling_rune_3 shooting_stars_moonfire 202497 2473323 8250 19.46 16936 35636 97.5 97.3 45.4% 0.0% 0.0% 0.0% 3.05sec 2473323 299.80sec
howling_rune_3 howling_rune_3 shooting_stars_sunfire 202497 2480130 8273 19.55 16915 35590 97.9 97.7 45.4% 0.0% 0.0% 0.0% 3.05sec 2480130 299.80sec
howling_rune_3 howling_rune_3 orbit_breaker 274283 1677681 5596 1.30 171336 361404 6.5 6.5 45.9% 0.0% 0.0% 0.0% 46.60sec 1677681 299.80sec
howling_rune_3 howling_rune_3 starfire 194153 1779168 5935 5.34 46980 93884 25.7 26.7 41.9% 0.0% 0.0% 0.0% 11.64sec 1779168 299.80sec
howling_rune_3 howling_rune_3 starsurge 78674 23977453 79978 23.57 138558 288266 118.0 117.8 43.4% 0.0% 0.0% 0.0% 2.53sec 23977453 299.80sec
howling_rune_3 howling_rune_3 goldrinns_fang 394047 8403327 28030 7.75 145712 301342 38.9 38.7 45.7% 0.0% 0.0% 0.0% 7.58sec 8403327 299.80sec
howling_rune_3 howling_rune_3 sunfire 93402 232909 777 3.48 9514 19307 17.4 17.4 39.6% 0.0% 0.0% 0.0% 18.05sec 4030203 299.80sec
howling_rune_3 howling_rune_3 sunfire ticks -93402 3797294 12658 63.83 8491 17238 17.4 319.1 39.0% 0.0% 0.0% 0.0% 18.05sec 4030203 299.80sec
howling_rune_3 howling_rune_3 tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 31.71sec 0 299.80sec
howling_rune_3 howling_rune_3 denizen_of_the_flame 426486 680819 2271 1.75 60496 120887 8.7 8.7 29.0% 0.0% 0.0% 0.0% 31.71sec 680819 299.80sec
howling_rune_3 howling_rune_3 denizen_of_the_flame_secondary 426431 625844 2088 3.38 28773 57487 16.9 16.9 28.9% 0.0% 0.0% 0.0% 15.41sec 625844 299.80sec
howling_rune_3 howling_rune_3 warrior_of_elune 202425 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 49.64sec 0 299.80sec
howling_rune_3 howling_rune_3 wrath 190984 7199726 24015 23.97 39807 82241 120.2 119.8 47.9% 0.0% 0.0% 0.0% 2.44sec 7199726 299.80sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
230652.8 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 5.2 0.0 57.5s 57.5s 54.0s 93.20% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Base
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 331.6s
  • trigger_min/max:6.0s / 331.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.2s
  • uptime_min/max:73.24% / 99.74%

Stack Uptimes

  • waning_twilight_1:93.20%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 4.9 0.0 60.3s 60.3s 57.2s 93.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:buzzing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 351.9s
  • trigger_min/max:6.0s / 351.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.4s
  • uptime_min/max:75.15% / 99.74%

Stack Uptimes

  • waning_twilight_1:93.86%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.2 0.0 57.6s 57.6s 54.0s 93.20% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:hissing_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 337.5s
  • trigger_min/max:6.0s / 337.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 353.7s
  • uptime_min/max:75.08% / 99.74%

Stack Uptimes

  • waning_twilight_1:93.20%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 4.8 0.0 60.3s 60.3s 57.9s 93.51% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:howling_rune_3
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 345.6s
  • trigger_min/max:6.0s / 345.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.4s
  • uptime_min/max:74.63% / 99.75%

Stack Uptimes

  • waning_twilight_1:93.51%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 82366
Mean 299.85
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.5701
5th Percentile 246.02
95th Percentile 353.93
( 95th Percentile - 5th Percentile ) 107.91
Mean Distribution
Standard Deviation 0.1205
95.00% Confidence Interval ( 299.62 - 300.09 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 511
0.1% Error 51061
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1021
DPS
Fluffy_Pillow Damage Per Second
Count 82366
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 82366
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 82366
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 82366
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 82366
Mean 248141.14
Minimum 212779.30
Maximum 295525.12
Spread ( max - min ) 82745.82
Range [ ( max - min ) / 2 * 100% ] 16.67%
Standard Deviation 9195.6874
5th Percentile 233589.88
95th Percentile 263763.36
( 95th Percentile - 5th Percentile ) 30173.48
Mean Distribution
Standard Deviation 32.0413
95.00% Confidence Interval ( 248078.34 - 248203.94 )
Normalized 95.00% Confidence Interval ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5276
0.1 Scale Factor Error with Delta=300 721859
0.05 Scale Factor Error with Delta=300 2887434
0.01 Scale Factor Error with Delta=300 72185850
HPS
Fluffy_Pillow Healing Per Second
Count 82366
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 82366
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 82366
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 82366
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 82366
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 82366
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 2967
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 77453751 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.